(data stored in ACNUC16935 zone)

EMBL: BN001307.PE103

BN001307.PE103       Location/Qualifiers
FT   CDS             join(279667..279851,279919..280147)
FT                   /locus_tag="ANIA_08963"
FT                   /old_locus_tag="AN8963.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007894"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007894"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007894"
FT                   /db_xref="GOA:Q5ARW7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW7"
FT                   /protein_id="CBF84559.1"
FT                   /translation="MAPAAAKAERLPRPATDYERWLGDDEQHLDSVRQYDLDQGQKDYT
FT                   NDGVITVAEDSSPPEIVDSDDLGSSPLSSDESSQPRHHYTRPTVPDIVALYAAIIIAVL
FT                   LVLKLHGSLRRPQWRRSEEKKRQGSPLGRDTND"
     MAPAAAKAER LPRPATDYER WLGDDEQHLD SVRQYDLDQG QKDYTNDGVI TVAEDSSPPE        60
     IVDSDDLGSS PLSSDESSQP RHHYTRPTVP DIVALYAAII IAVLLVLKLH GSLRRPQWRR       120
     SEEKKRQGSP LGRDTND                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page