(data stored in ACNUC16935 zone)

EMBL: BN001307.PE105

BN001307.PE105       Location/Qualifiers
FT   CDS             284103..286727
FT                   /locus_tag="ANIA_08961"
FT                   /old_locus_tag="AN8961.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007896"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007896"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007896"
FT                   /db_xref="GOA:Q5ARW9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARW9"
FT                   /protein_id="CBF84563.1"
FT                   /translation="MIKPEPTRTKNQAPRFYRQYIDENDSLSAAPSPVSSLLPPHLRTP
FT                   SLPSSRNEAKDATGRAQPRRSLDIASKALGIKSLTLNSTDAVTQTTAPLLDARPTLTLH
FT                   LPNGRVLPPLSPTASNFSPRVRSSSLGQTGSQHVGQASGTGHYRSASHTFSSPTTPIAI
FT                   LHPPRPPYCNASSGPLLFRNPVPSPVITIREPSPPPSESRSAVQTQTQSRKNSTDLGET
FT                   ATARLEQVPGGAAAFSGRVEKSVSAPDALASGDPLLRQSGSRPSLEDNTYSHDHTPDIA
FT                   GRREVRQRETNAPNPCQETEEPMLDNISDKAPLSPPAHRSSFDSSNNQRSRGRSMELTR
FT                   TKHVRRPRHRASTQPLQMADPMFISISGKEFSSQGNGGSSRSSLETSSRDRSLTLPGSL
FT                   PQQPNDNTSTNSLQTTVRGSVPDTRSVAVTRLTSLNSHPPSSVIEREHTRSQSLDVNHH
FT                   SGPPAVPRHIYASLPLPRIRLPSIHSKADASSAQATDSEATISHSAGPASSLPTGPRTP
FT                   THAVFPHPQPQPQPQSEAMFTSRASSLPVTTPPAFSSPAPNSHSALQSLSPHLEAHQPT
FT                   TRLSLSKFTTQSLTTLRAVASASKIHSSSTSLSTPRSKSNSSSSSNSTASASTTSVLTP
FT                   QSPPFRPPSPTDTSNLPLATLTQHMKTQLGQARHLLATLSHHLPPAENIWIHDTVSDAE
FT                   GTVREILMLTEPLRVDREVNNGKLGLKTQLKWAVRGSWKAKDMRARLNLCYSSLVAILM
FT                   RLQDYEAEYAESVAEHAAAKTETMTSDDRNPMTSTNVHVEGPTTSELESLHKYSAMQME
FT                   GLSLESVVDEHTGIETRSAGPQSPISTISREESIEPAPEKLDNELVDMLSWRWSQGREK
FT                   TTQ"
     MIKPEPTRTK NQAPRFYRQY IDENDSLSAA PSPVSSLLPP HLRTPSLPSS RNEAKDATGR        60
     AQPRRSLDIA SKALGIKSLT LNSTDAVTQT TAPLLDARPT LTLHLPNGRV LPPLSPTASN       120
     FSPRVRSSSL GQTGSQHVGQ ASGTGHYRSA SHTFSSPTTP IAILHPPRPP YCNASSGPLL       180
     FRNPVPSPVI TIREPSPPPS ESRSAVQTQT QSRKNSTDLG ETATARLEQV PGGAAAFSGR       240
     VEKSVSAPDA LASGDPLLRQ SGSRPSLEDN TYSHDHTPDI AGRREVRQRE TNAPNPCQET       300
     EEPMLDNISD KAPLSPPAHR SSFDSSNNQR SRGRSMELTR TKHVRRPRHR ASTQPLQMAD       360
     PMFISISGKE FSSQGNGGSS RSSLETSSRD RSLTLPGSLP QQPNDNTSTN SLQTTVRGSV       420
     PDTRSVAVTR LTSLNSHPPS SVIEREHTRS QSLDVNHHSG PPAVPRHIYA SLPLPRIRLP       480
     SIHSKADASS AQATDSEATI SHSAGPASSL PTGPRTPTHA VFPHPQPQPQ PQSEAMFTSR       540
     ASSLPVTTPP AFSSPAPNSH SALQSLSPHL EAHQPTTRLS LSKFTTQSLT TLRAVASASK       600
     IHSSSTSLST PRSKSNSSSS SNSTASASTT SVLTPQSPPF RPPSPTDTSN LPLATLTQHM       660
     KTQLGQARHL LATLSHHLPP AENIWIHDTV SDAEGTVREI LMLTEPLRVD REVNNGKLGL       720
     KTQLKWAVRG SWKAKDMRAR LNLCYSSLVA ILMRLQDYEA EYAESVAEHA AAKTETMTSD       780
     DRNPMTSTNV HVEGPTTSEL ESLHKYSAMQ MEGLSLESVV DEHTGIETRS AGPQSPISTI       840
     SREESIEPAP EKLDNELVDM LSWRWSQGRE KTTQ                                   874
//

If you have problems or comments...

PBIL Back to PBIL home page