(data stored in ACNUC16935 zone)

EMBL: BN001307.PE107

BN001307.PE107       Location/Qualifiers
FT   CDS             join(289633..289918,289973..290589)
FT                   /locus_tag="ANIA_08960"
FT                   /old_locus_tag="AN8960.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007898"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007898"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007898"
FT                   /db_xref="GOA:Q5ARX0"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX0"
FT                   /protein_id="CBF84567.1"
FT                   /translation="MAATAQSQSEEVAVEIKANATVHNREIGTDESVLFEDTRTPHAPQ
FT                   APSTMNIAIRPNAPQDLPVLLSRVSKLGASYAQNEDEDIRAEYLDAGPPSRSLPATAEN
FT                   AFNVRRAHYAAIETCVDLGVFVSLSKDDTPKTVAELAKATHADPLLLCMLLPQRVLLFS
FT                   PIWHADKPARLLKHLSTMGVIIETSEDTYLCNGFSTSLSNKRYSDAYPCMFARYLPLYS
FT                   SFQQSPLIPSLGPTASHTASPACPRFSREPTTPTQAMVAIPRSKTDNASASTSSNSPRN
FT                   TSPTAQSSITTGQPTVRPT"
     MAATAQSQSE EVAVEIKANA TVHNREIGTD ESVLFEDTRT PHAPQAPSTM NIAIRPNAPQ        60
     DLPVLLSRVS KLGASYAQNE DEDIRAEYLD AGPPSRSLPA TAENAFNVRR AHYAAIETCV       120
     DLGVFVSLSK DDTPKTVAEL AKATHADPLL LCMLLPQRVL LFSPIWHADK PARLLKHLST       180
     MGVIIETSED TYLCNGFSTS LSNKRYSDAY PCMFARYLPL YSSFQQSPLI PSLGPTASHT       240
     ASPACPRFSR EPTTPTQAMV AIPRSKTDNA SASTSSNSPR NTSPTAQSSI TTGQPTVRPT       300
//

If you have problems or comments...

PBIL Back to PBIL home page