(data stored in ACNUC16935 zone)

EMBL: BN001307.PE108

BN001307.PE108       Location/Qualifiers
FT   CDS             complement(join(291627..292066,292162..292264))
FT                   /locus_tag="ANIA_08959"
FT                   /old_locus_tag="AN8959.4"
FT                   /product="benzodiazepine receptor family protein
FT                   (AFU_orthologue; AFUA_3G01430)"
FT                   /note="transcript_id=CADANIAT00007899"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007899"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007899"
FT                   /db_xref="GOA:Q5ARX1"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX1"
FT                   /protein_id="CBF84569.1"
FT                   /translation="MPWSFVLPQAIFASPLLATLTPVATGSTIGYLVNRYGTKPKYHAL
FT                   KQPPASPPSWLFPPVWTLLYGLTGYASYHFTVNTLEPDTTITQTLYTAQLFLNHLWMPL
FT                   FFAARKPILAAGDIVLLGGTVATLMRELWGSDRVSFWLFAPYAAWLGYATYLNFGTGIL
FT                   NNWRIPDVPEERKRRNE"
     MPWSFVLPQA IFASPLLATL TPVATGSTIG YLVNRYGTKP KYHALKQPPA SPPSWLFPPV        60
     WTLLYGLTGY ASYHFTVNTL EPDTTITQTL YTAQLFLNHL WMPLFFAARK PILAAGDIVL       120
     LGGTVATLMR ELWGSDRVSF WLFAPYAAWL GYATYLNFGT GILNNWRIPD VPEERKRRNE       180
//

If you have problems or comments...

PBIL Back to PBIL home page