(data stored in ACNUC16935 zone)

EMBL: BN001307.PE109

BN001307.PE109       Location/Qualifiers
FT   CDS             complement(join(292710..293443,293521..293584))
FT                   /locus_tag="ANIA_08958"
FT                   /old_locus_tag="AN8958.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007900"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007900"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007900"
FT                   /db_xref="GOA:Q5ARX2"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX2"
FT                   /protein_id="CBF84571.1"
FT                   /translation="MSSLLQAKPHLTAALSFLAFGASACRNIIESSEGAPGPPQRTDKS
FT                   ALLSEWPGSNGIKRETQKTHWVTSLVALQVDVPVAQLVRCGISEVGDAYDLARNLFSAF
FT                   LDARARGLEAWFLDKDVPQLSFTPWSLLFGRSHSAGAFMLGHWSSARRIQLDQPILHSE
FT                   TANPICEFRPSKAMITASNINAETDAAGTVLYWKFPRRSVDQVDKAASYGIPWRLMEGA
FT                   FQEFIVEKITSETTKVTYVTVGCGNMYPGGQRERTSKGAVVVV"
     MSSLLQAKPH LTAALSFLAF GASACRNIIE SSEGAPGPPQ RTDKSALLSE WPGSNGIKRE        60
     TQKTHWVTSL VALQVDVPVA QLVRCGISEV GDAYDLARNL FSAFLDARAR GLEAWFLDKD       120
     VPQLSFTPWS LLFGRSHSAG AFMLGHWSSA RRIQLDQPIL HSETANPICE FRPSKAMITA       180
     SNINAETDAA GTVLYWKFPR RSVDQVDKAA SYGIPWRLME GAFQEFIVEK ITSETTKVTY       240
     VTVGCGNMYP GGQRERTSKG AVVVV                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page