(data stored in ACNUC16935 zone)

EMBL: BN001307.PE112

BN001307.PE112       Location/Qualifiers
FT   CDS             complement(join(305462..305891,305951..306293,
FT                   306383..306567,306627..306847,306895..306982,
FT                   307051..307205))
FT                   /locus_tag="ANIA_08955"
FT                   /old_locus_tag="AN8955.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007903"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007903"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007903"
FT                   /db_xref="GOA:Q5ARX5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX5"
FT                   /protein_id="CBF84576.1"
FT                   /translation="MEDKKVVLDSGSSEELEQGFSSNGNGYDTVATKKLIRKIDFVLIP
FT                   WLALLYLLSFLDRTNIGNARLAGLETDLNMSGLDYNVALAIFFPFYVAAEIPSNIMMKR
FT                   SRPSLWIPSIMIAWAVVCSLMGLVQNYAGLLVARAALGIAEGGLFPGVTFYITMWYKRH
FT                   ECGLRMAIFFSAATAAGAFGGLLARGIGEMDGIGGKGGWAWIFIIEGILTFVIAKFLTS
FT                   AEKAEVQRRLEEDRSSLADEYNMKFFWDAIKDWKIWVHMFVTVGVYTPLYSFSLFLPTI
FT                   VSSLGYENEEAQLMTVPPYVVACVFCIGGGFLADRQGQRGIYMIGFNIVAIIGFIMLIS
FT                   SDNNGVKYAGTFFAASGIYPNVPQGVAWNGNNIGGSFKRSVGIAMHVGCGNLGGVLSSF
FT                   IYRSQDKPHYRVGHGTLIGCLTMSTVLCTIMTIYLRRENARRDREYKPPAEYSEAERAA
FT                   EREKGDDASFFRYTI"
     MEDKKVVLDS GSSEELEQGF SSNGNGYDTV ATKKLIRKID FVLIPWLALL YLLSFLDRTN        60
     IGNARLAGLE TDLNMSGLDY NVALAIFFPF YVAAEIPSNI MMKRSRPSLW IPSIMIAWAV       120
     VCSLMGLVQN YAGLLVARAA LGIAEGGLFP GVTFYITMWY KRHECGLRMA IFFSAATAAG       180
     AFGGLLARGI GEMDGIGGKG GWAWIFIIEG ILTFVIAKFL TSAEKAEVQR RLEEDRSSLA       240
     DEYNMKFFWD AIKDWKIWVH MFVTVGVYTP LYSFSLFLPT IVSSLGYENE EAQLMTVPPY       300
     VVACVFCIGG GFLADRQGQR GIYMIGFNIV AIIGFIMLIS SDNNGVKYAG TFFAASGIYP       360
     NVPQGVAWNG NNIGGSFKRS VGIAMHVGCG NLGGVLSSFI YRSQDKPHYR VGHGTLIGCL       420
     TMSTVLCTIM TIYLRRENAR RDREYKPPAE YSEAERAAER EKGDDASFFR YTI              473
//

If you have problems or comments...

PBIL Back to PBIL home page