(data stored in ACNUC16935 zone)

EMBL: BN001307.PE114

BN001307.PE114       Location/Qualifiers
FT   CDS             complement(join(309909..310473,311092..311521,
FT                   311587..311625,311808..312216))
FT                   /locus_tag="ANIA_08954"
FT                   /old_locus_tag="AN8954.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007905"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007905"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007905"
FT                   /db_xref="GOA:Q5ARX6"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX6"
FT                   /protein_id="CBF84580.1"
FT                   /translation="MSDRKLILVMGILALRALPLSRVRRIPDGIARNSSLTWRMIALSS
FT                   SGRYDVRVLTRNTASEQARKMVVLPQVTLQQGFQETRQISTLPSPAYTAPGRLYARGKS
FT                   ELIYGIRAYEIARHHGVKHYVFANIDYTLRKAGKEDGSFAWENPAADGKIPLIALDDVG
FT                   VYSLWLFDNPSQSAGLNLEVATDQVSFAEIATTFTKVTRKKGIHKRLSLDEYLDEAELY
FT                   PGAYANWAVASDVPRDESFMTWRENFTAWWGYWSEGKGATRDMALMDRIHPSRIPSLEA
FT                   WMRMKGYDGRPRLHPPYPIIMASFLVDGRFPPVPLPPSKDIKSEERSTAIDFVNRHNLI
FT                   FQEFNYDKVTATFLPDAIVYHSHGTIRGHAEIKQFLENVYGFFIPGIGRSATNHVVDRD
FT                   ENGGVVVRYQETLIRYGWGEGEPDADVVAGRDIVRADGLPAIWWFGQVVDRLRIAANGW
FT                   RILERYLGGSFRNQSLDLTNKV"
     MSDRKLILVM GILALRALPL SRVRRIPDGI ARNSSLTWRM IALSSSGRYD VRVLTRNTAS        60
     EQARKMVVLP QVTLQQGFQE TRQISTLPSP AYTAPGRLYA RGKSELIYGI RAYEIARHHG       120
     VKHYVFANID YTLRKAGKED GSFAWENPAA DGKIPLIALD DVGVYSLWLF DNPSQSAGLN       180
     LEVATDQVSF AEIATTFTKV TRKKGIHKRL SLDEYLDEAE LYPGAYANWA VASDVPRDES       240
     FMTWRENFTA WWGYWSEGKG ATRDMALMDR IHPSRIPSLE AWMRMKGYDG RPRLHPPYPI       300
     IMASFLVDGR FPPVPLPPSK DIKSEERSTA IDFVNRHNLI FQEFNYDKVT ATFLPDAIVY       360
     HSHGTIRGHA EIKQFLENVY GFFIPGIGRS ATNHVVDRDE NGGVVVRYQE TLIRYGWGEG       420
     EPDADVVAGR DIVRADGLPA IWWFGQVVDR LRIAANGWRI LERYLGGSFR NQSLDLTNKV       480
//

If you have problems or comments...

PBIL Back to PBIL home page