(data stored in ACNUC16935 zone)

EMBL: BN001307.PE115

BN001307.PE115       Location/Qualifiers
FT   CDS             complement(join(313255..313922,313981..314114,
FT                   314172..314307,314380..316309))
FT                   /locus_tag="ANIA_08953"
FT                   /old_locus_tag="AN8953.4"
FT                   /product="Alpha-glucosidase BPutative uncharacterized
FT                   protein Precursor ; [Source:UniProtKB/TrEMBL;Acc:Q9C1S7]"
FT                   /note="transcript_id=CADANIAT00007906"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007906"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007906"
FT                   /db_xref="GOA:G5EB11"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR031727"
FT                   /db_xref="UniProtKB/TrEMBL:G5EB11"
FT                   /protein_id="CBF84581.1"
FT                   /translation="MRFQQLLPWAAALTGCVVAQSQAGVDPLDRPGNDLYVKDLSNCTG
FT                   YKVTKHWKTRSGFYADLALAGPACNVYGIDLPKLKLEVEYQTDERLHVKILDTNNTVYQ
FT                   VPDSVFPRPGFGQWCSPKNSKLKFDFKPDPFSFTVSRTDTGEVLFDTTGTKLVFENQYL
FT                   YLKTHLPQNPHLYGLGEHSDSFMLNTTNYTRTIYTRDAYGTPQGQNLYGAHPIYFDHRQ
FT                   DGTHGVFLLNSNGMDIYIDNEGGQFLEYNIIGGVFDFYFIAGPSPQDVARQYAEIVQPP
FT                   LMVPYWGLGFHQCRYGYQDVYEVAAVTANYSVHDIPLETIWTDIDYMDRRRIFTLDPER
FT                   FPPELVKDLVDTLHARDQHYIVMVDPAVYYSEPNPALDAGLKYDAFMKELNGTHYQGVV
FT                   WAGPSYFPDWFHPNAQEYWTEQFLNFFDGVNGPDIDALWIDMNEPANFYNRPYPGNNTT
FT                   PEEFAEANDNPPEPPAVRDGPDAPIPGFPDSLQPNFASGQTNEKRAVVTVERRARSQSH
FT                   RQLGAGRWRSAVRHWPRDPKAGWQHGRKSGSGCGPHECRGLPNRELIRPPYMIQNGAGP
FT                   TLADNTADTDIVQSGGYVQYDTHSLYGAMMSTHSHNAMRARRPDDRALVITRSTFAGSG
FT                   KDVSHWLGDNISDWLSYRLSISQILQFASLYQIPVVGPDVCGFGGNVTETLCARWATLG
FT                   SFYTFFRNHAEIFANPQEFYRWPIVAEAARNGIAIRYQLLDYIYTAIYKQTQTGTPSLN
FT                   PLFFNYPFDQNTYGIDLQFFYGPGILVSPVTEENSTSVSYYLPDDIFYEWGTGKPVRGH
FT                   GEYVSAEVDVTHITVHYKGGLVYPQRIESANTTTALRQKGFNIVIAPGLDGSAHGELYL
FT                   DDGLSQVQDKVSEIDFSYVDGVFEMKGSFEYDPGVGIERITILGVGAKPEVAAEDAEVE
FT                   YDEENQKLVLHVDVPLTRKSSIKIA"
     MRFQQLLPWA AALTGCVVAQ SQAGVDPLDR PGNDLYVKDL SNCTGYKVTK HWKTRSGFYA        60
     DLALAGPACN VYGIDLPKLK LEVEYQTDER LHVKILDTNN TVYQVPDSVF PRPGFGQWCS       120
     PKNSKLKFDF KPDPFSFTVS RTDTGEVLFD TTGTKLVFEN QYLYLKTHLP QNPHLYGLGE       180
     HSDSFMLNTT NYTRTIYTRD AYGTPQGQNL YGAHPIYFDH RQDGTHGVFL LNSNGMDIYI       240
     DNEGGQFLEY NIIGGVFDFY FIAGPSPQDV ARQYAEIVQP PLMVPYWGLG FHQCRYGYQD       300
     VYEVAAVTAN YSVHDIPLET IWTDIDYMDR RRIFTLDPER FPPELVKDLV DTLHARDQHY       360
     IVMVDPAVYY SEPNPALDAG LKYDAFMKEL NGTHYQGVVW AGPSYFPDWF HPNAQEYWTE       420
     QFLNFFDGVN GPDIDALWID MNEPANFYNR PYPGNNTTPE EFAEANDNPP EPPAVRDGPD       480
     APIPGFPDSL QPNFASGQTN EKRAVVTVER RARSQSHRQL GAGRWRSAVR HWPRDPKAGW       540
     QHGRKSGSGC GPHECRGLPN RELIRPPYMI QNGAGPTLAD NTADTDIVQS GGYVQYDTHS       600
     LYGAMMSTHS HNAMRARRPD DRALVITRST FAGSGKDVSH WLGDNISDWL SYRLSISQIL       660
     QFASLYQIPV VGPDVCGFGG NVTETLCARW ATLGSFYTFF RNHAEIFANP QEFYRWPIVA       720
     EAARNGIAIR YQLLDYIYTA IYKQTQTGTP SLNPLFFNYP FDQNTYGIDL QFFYGPGILV       780
     SPVTEENSTS VSYYLPDDIF YEWGTGKPVR GHGEYVSAEV DVTHITVHYK GGLVYPQRIE       840
     SANTTTALRQ KGFNIVIAPG LDGSAHGELY LDDGLSQVQD KVSEIDFSYV DGVFEMKGSF       900
     EYDPGVGIER ITILGVGAKP EVAAEDAEVE YDEENQKLVL HVDVPLTRKS SIKIA            955
//

If you have problems or comments...

PBIL Back to PBIL home page