(data stored in ACNUC16935 zone)

EMBL: BN001307.PE117

BN001307.PE117       Location/Qualifiers
FT   CDS             join(322496..322669,322741..323121,323158..323228,
FT                   323377..323824)
FT                   /locus_tag="ANIA_08951"
FT                   /old_locus_tag="AN8951.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007908"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007908"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007908"
FT                   /db_xref="GOA:Q5ARX9"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARX9"
FT                   /protein_id="CBF84585.1"
FT                   /translation="MASEPSAAYLAEDRSQPALIGIVVVTALSAVVVIVRLYARRVLVR
FT                   GLGWDDLFIVLAQLVSWATMALCSQILRYGSGRHLVALLKTPETLVRMYKWLVTTQMVY
FT                   MFNLWLCRVSGLTFYARLNPMPRFILYLRLSFAFVTAVWAAQSLIIALQCIPLEALWDN
FT                   SITDKKCMGSAMVFISTGALTIIVMGLQAKTARKLALLGILCFGVLTSILRMVSMIVSV
FT                   QHEDDATWYFSPVVAWTCAEISAAIIALSLPALRAIFGFLKEHHSTRGKSNSYPNTGSG
FT                   SKGIGLDSLSKSATKQPKVFHGSGVYDNTVDIGVGRSPSQEVLWNGYGDRSYGNRGNGS
FT                   PREIMITETVDVEVGRG"
     MASEPSAAYL AEDRSQPALI GIVVVTALSA VVVIVRLYAR RVLVRGLGWD DLFIVLAQLV        60
     SWATMALCSQ ILRYGSGRHL VALLKTPETL VRMYKWLVTT QMVYMFNLWL CRVSGLTFYA       120
     RLNPMPRFIL YLRLSFAFVT AVWAAQSLII ALQCIPLEAL WDNSITDKKC MGSAMVFIST       180
     GALTIIVMGL QAKTARKLAL LGILCFGVLT SILRMVSMIV SVQHEDDATW YFSPVVAWTC       240
     AEISAAIIAL SLPALRAIFG FLKEHHSTRG KSNSYPNTGS GSKGIGLDSL SKSATKQPKV       300
     FHGSGVYDNT VDIGVGRSPS QEVLWNGYGD RSYGNRGNGS PREIMITETV DVEVGRG          357
//

If you have problems or comments...

PBIL Back to PBIL home page