(data stored in ACNUC16935 zone)

EMBL: BN001307.PE118

BN001307.PE118       Location/Qualifiers
FT   CDS             join(327758..327859,327908..327979,328030..328170,
FT                   328210..328270,328317..328358,328415..328459,
FT                   328510..328517,328663..328750,328791..328880,
FT                   329035..329073,329124..329204,329257..329316,
FT                   329370..329422)
FT                   /locus_tag="ANIA_09432"
FT                   /old_locus_tag="AN9432.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007909"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007909"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQJ8"
FT                   /protein_id="CBF84587.1"
FT                   /translation="MPSIRDNDLRKSPEYCHYLEAVKDGELTLPDFKIDDNGVPDIHPY
FT                   EVYCRVKGCLKRTVPSANRNILVKHLKDKNSHGMEFTLHNGPPTMKELMEAKGKSYLDY
FT                   LACLKALFSQPRLLPRSASELPPSPRTTILRVSRIPTRVKLEMIRTMARALQVIRREGS
FT                   KAAKSAGEKGTIPCKTCRNAKGKVSAPCGSKPYCEFWRFFSSIDEAKGASMQPHMDNAK
FT                   ETSNEESVLNKENEHENEEEKAAEPEEVQGDGRHVSEHLAITPFAQLNSGEDNSIATNL
FT                   DLRDFGLNLESI"
     MPSIRDNDLR KSPEYCHYLE AVKDGELTLP DFKIDDNGVP DIHPYEVYCR VKGCLKRTVP        60
     SANRNILVKH LKDKNSHGME FTLHNGPPTM KELMEAKGKS YLDYLACLKA LFSQPRLLPR       120
     SASELPPSPR TTILRVSRIP TRVKLEMIRT MARALQVIRR EGSKAAKSAG EKGTIPCKTC       180
     RNAKGKVSAP CGSKPYCEFW RFFSSIDEAK GASMQPHMDN AKETSNEESV LNKENEHENE       240
     EEKAAEPEEV QGDGRHVSEH LAITPFAQLN SGEDNSIATN LDLRDFGLNL ESI              293
//

If you have problems or comments...

PBIL Back to PBIL home page