(data stored in ACNUC16935 zone)

EMBL: BN001307.PE119

BN001307.PE119       Location/Qualifiers
FT   CDS             complement(join(329786..329814,329963..330312,
FT                   330359..330542,330591..330712,330767..330870,
FT                   330919..330968,331017..331094,331285..331461,
FT                   331522..331702,331769..331861,332566..332659,
FT                   332719..332954,333039..333077,333232..333279))
FT                   /locus_tag="ANIA_09431"
FT                   /old_locus_tag="AN9431.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007910"
FT                   /db_xref="UniProtKB/TrEMBL:C8VD93"
FT                   /protein_id="CBF84589.1"
FT                   /translation="MSTTPQIPGAIDVPEQNGYTYIVPLDPNRTQYHARQLERYDAQSP
FT                   YIRGRVTRIQYQCSGVRICSYLHPNLRNMHHYKVTEDDWNYIRQERQLIEETEMDPKKQ
FT                   KAISHFFGVLRVFKRHQACRPQQVGCAPKMVLGEAALIYREKLAFYPDGQDLNALQLEC
FT                   DRNEYLKHYVREIYHEGDITIIICILQDQAKLFQSLRSFEVDMSFKRVREGRFNEVIFA
FT                   VFLEDHGKVITLLRAFMNQQTGRAYYFLFKKVFEMIHDLSGHPVQFFHLHGTGIETIVV
FT                   DMDEGQRDVLFKAMISLLHAPTRAQYMDILEQLLEDPTPGVATWAEHKLHPHFNQTRMH
FT                   TNAGEQTHQKSYAFSGKHLPILKAVTSAYFLDVRDMHQYSVRIHYNITHSYRPDDEISR
FT                   ITENLIRDQRKRRRNQEIEEEENIEGVLPRRARPSRSFSSSGSPRPRRSRSSTRGRSYT
FT                   RGVSRSSTPQRSPSLAQIASQNYRDQQASHEQHILDLRERQARLDRYEVETRLMQQRLL
FT                   QPTSPQLVGVNPVQYPPLPGYLPSSSQLVNPGPVYVPQMTGALPYVPSQAPFVPSTETS
FT                   HQLVYQDSQARSFSTVSC"
     MSTTPQIPGA IDVPEQNGYT YIVPLDPNRT QYHARQLERY DAQSPYIRGR VTRIQYQCSG        60
     VRICSYLHPN LRNMHHYKVT EDDWNYIRQE RQLIEETEMD PKKQKAISHF FGVLRVFKRH       120
     QACRPQQVGC APKMVLGEAA LIYREKLAFY PDGQDLNALQ LECDRNEYLK HYVREIYHEG       180
     DITIIICILQ DQAKLFQSLR SFEVDMSFKR VREGRFNEVI FAVFLEDHGK VITLLRAFMN       240
     QQTGRAYYFL FKKVFEMIHD LSGHPVQFFH LHGTGIETIV VDMDEGQRDV LFKAMISLLH       300
     APTRAQYMDI LEQLLEDPTP GVATWAEHKL HPHFNQTRMH TNAGEQTHQK SYAFSGKHLP       360
     ILKAVTSAYF LDVRDMHQYS VRIHYNITHS YRPDDEISRI TENLIRDQRK RRRNQEIEEE       420
     ENIEGVLPRR ARPSRSFSSS GSPRPRRSRS STRGRSYTRG VSRSSTPQRS PSLAQIASQN       480
     YRDQQASHEQ HILDLRERQA RLDRYEVETR LMQQRLLQPT SPQLVGVNPV QYPPLPGYLP       540
     SSSQLVNPGP VYVPQMTGAL PYVPSQAPFV PSTETSHQLV YQDSQARSFS TVSC             594
//

If you have problems or comments...

PBIL Back to PBIL home page