(data stored in ACNUC16935 zone)

EMBL: BN001307.PE120

BN001307.PE120       Location/Qualifiers
FT   CDS             complement(join(335803..335849,336154..336544))
FT                   /locus_tag="ANIA_08950"
FT                   /old_locus_tag="AN8950.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007911"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007911"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007911"
FT                   /db_xref="GOA:Q5ARY0"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY0"
FT                   /protein_id="CBF84591.1"
FT                   /translation="MAHHDPLHTAPTRRNLPIEVSYSIGPCNSSMDHNVSQLERKPDRN
FT                   DGFQRYLEATGATIYQSWHPPHTASPYPVQSDGQFHIPNSQSQNLGFPASTSSFMQPSV
FT                   AQADYHYPMNAHAPSTVMSDLPLAREKWFNRPPLLYPFQFT"
     MAHHDPLHTA PTRRNLPIEV SYSIGPCNSS MDHNVSQLER KPDRNDGFQR YLEATGATIY        60
     QSWHPPHTAS PYPVQSDGQF HIPNSQSQNL GFPASTSSFM QPSVAQADYH YPMNAHAPST       120
     VMSDLPLARE KWFNRPPLLY PFQFT                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page