(data stored in ACNUC16935 zone)

EMBL: BN001307.PE121

BN001307.PE121       Location/Qualifiers
FT   CDS             join(336946..337921,338491..339184,339596..339630,
FT                   339803..339992,340058..340145,340236..340589)
FT                   /locus_tag="ANIA_08949"
FT                   /old_locus_tag="AN8949.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007912"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007912"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007912"
FT                   /db_xref="GOA:Q5ARY1"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY1"
FT                   /protein_id="CBF84592.1"
FT                   /translation="MSTTSTPRHRPISFVGKWLDTIEERPAPQSTSYPRRSPIPSASSN
FT                   LTGSTLVWPRARQDTGITQDTRVVVVKSPRPKKSKKDAFCAIFRSWKATLTTRTTSHET
FT                   FPATVRENPELAIAELSSHLSANFAVLIETALRNSPSKALSARRICKEIMRADNWYRAH
FT                   ENLGWQESVARELSLSPSFQPVIECREGRVRNKGVKWQLTAVDVSLAPATAPWRPPQDS
FT                   VPYPLELSTEVEATERQTEPSRAENSDTPQPRRPSAGLPALAALASASLLSSALPLHPE
FT                   EDTIPKDEALVSGFSKRLFFTAPGPSRSPANISFNDAPPPSHQSDTPTVPPPLRPPPPS
FT                   LDIPESLPVQVDSSARPSPASSTALSADPLATADASSVQVSTPSSCAQQLYDSPLPITA
FT                   AVRVLKHNIHCIEKRLSLVENTTIQLLQKWEMPSGRGPNLIVPAHSLGSSIYSRCNPSN
FT                   GSMLSPGNYNPSFSQSNNSLSNCPPLGSSTAVTTRTPSEKAPSEEFPSPDFDVLLSFEN
FT                   PDNPRAGATNADDDGGLVEDRFMPDLDLEAWNEEHNGALGVLEKERLGTDNPTILEYSE
FT                   GSGPYFDETAANPWRLSSSNGAKQIQTTPNLSLNFYRPLQTTKRTRLQPTTWRMTSRIK
FT                   AVDINYYVLWYENILDTKAPNNQLDWVRDGRLVVSVWSTVEGQNAIVEAAIDNNLDMVQ
FT                   YPFSKGPDIDEVGIKGPAGDESYNDMGIPLHQAATDGYTEMALFLADAGANTHLKDPMG
FT                   RTAEDLALEKDHTEILTLYAGKRVP"
     MSTTSTPRHR PISFVGKWLD TIEERPAPQS TSYPRRSPIP SASSNLTGST LVWPRARQDT        60
     GITQDTRVVV VKSPRPKKSK KDAFCAIFRS WKATLTTRTT SHETFPATVR ENPELAIAEL       120
     SSHLSANFAV LIETALRNSP SKALSARRIC KEIMRADNWY RAHENLGWQE SVARELSLSP       180
     SFQPVIECRE GRVRNKGVKW QLTAVDVSLA PATAPWRPPQ DSVPYPLELS TEVEATERQT       240
     EPSRAENSDT PQPRRPSAGL PALAALASAS LLSSALPLHP EEDTIPKDEA LVSGFSKRLF       300
     FTAPGPSRSP ANISFNDAPP PSHQSDTPTV PPPLRPPPPS LDIPESLPVQ VDSSARPSPA       360
     SSTALSADPL ATADASSVQV STPSSCAQQL YDSPLPITAA VRVLKHNIHC IEKRLSLVEN       420
     TTIQLLQKWE MPSGRGPNLI VPAHSLGSSI YSRCNPSNGS MLSPGNYNPS FSQSNNSLSN       480
     CPPLGSSTAV TTRTPSEKAP SEEFPSPDFD VLLSFENPDN PRAGATNADD DGGLVEDRFM       540
     PDLDLEAWNE EHNGALGVLE KERLGTDNPT ILEYSEGSGP YFDETAANPW RLSSSNGAKQ       600
     IQTTPNLSLN FYRPLQTTKR TRLQPTTWRM TSRIKAVDIN YYVLWYENIL DTKAPNNQLD       660
     WVRDGRLVVS VWSTVEGQNA IVEAAIDNNL DMVQYPFSKG PDIDEVGIKG PAGDESYNDM       720
     GIPLHQAATD GYTEMALFLA DAGANTHLKD PMGRTAEDLA LEKDHTEILT LYAGKRVP         778
//

If you have problems or comments...

PBIL Back to PBIL home page