(data stored in ACNUC16935 zone)

EMBL: BN001307.PE122

BN001307.PE122       Location/Qualifiers
FT   CDS             join(341446..341463,341734..341798,341839..342193)
FT                   /locus_tag="ANIA_08948"
FT                   /old_locus_tag="AN8948.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007913"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007913"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007913"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY2"
FT                   /protein_id="CBF84594.1"
FT                   /translation="MRIPAVLAEYRLDLPRARNQAPGLQRLRVRIAVIDPMCTWMYPTD
FT                   ITVHLGSTRLAVYYAPGVSLGRGFALGGMIADSGDLLGCVSASCAGGWFEVRIGEGEKL
FT                   VTLISKFKEEITNSRLNALRLYSNFHLALVGSPRMRLGNKS"
     MRIPAVLAEY RLDLPRARNQ APGLQRLRVR IAVIDPMCTW MYPTDITVHL GSTRLAVYYA        60
     PGVSLGRGFA LGGMIADSGD LLGCVSASCA GGWFEVRIGE GEKLVTLISK FKEEITNSRL       120
     NALRLYSNFH LALVGSPRMR LGNKS                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page