(data stored in ACNUC16935 zone)

EMBL: BN001307.PE125

BN001307.PE125       Location/Qualifiers
FT   CDS             complement(join(349713..349801,349846..349936))
FT                   /locus_tag="ANIA_11155"
FT                   /old_locus_tag="AN11155.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007916"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007916"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007916"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLB3"
FT                   /protein_id="CBF84600.1"
FT                   /translation="MPRSLASSSSSQSDKTKTSQTSLSGKSDELAPGEAPVSLSGMQHL
FT                   DRHGKVISTFSIEY"
     MPRSLASSSS SQSDKTKTSQ TSLSGKSDEL APGEAPVSLS GMQHLDRHGK VISTFSIEY         59
//

If you have problems or comments...

PBIL Back to PBIL home page