(data stored in ACNUC16935 zone)

EMBL: BN001307.PE127

BN001307.PE127       Location/Qualifiers
FT   CDS             complement(join(355631..355772,356092..356250,
FT                   356322..356407,356580..356775,356834..357011,
FT                   357124..357277))
FT                   /locus_tag="ANIA_08944"
FT                   /old_locus_tag="AN8944.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007918"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007918"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007918"
FT                   /db_xref="GOA:Q5ARY6"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY6"
FT                   /protein_id="CBF84604.1"
FT                   /translation="MPTYPHSRTTETPQIACQAHYGLIGSVAQALNHYTVRPRCKEIVS
FT                   FNHTFPADLGDGSSPFDARNIDNAGDAEIRKHQACPHRRLFRLLEACGEWQPRFGSKVQ
FT                   STHGMSEAGFFAVPDPNEPVQDANMGIFVPNVEAKFLDESSDVLSLNEEGVYICTPFVR
FT                   KGYLDEPTHTAQAARPVTRSEIETAVSRHPGVRDVAVIPVVLPGSECPAPRAYIVKTYG
FT                   SSLLIEELISCMATKYLPRMQLTGGAAFVDAIEQIWVHGWGHRIEVQIPSLLQIEASII
FT                   PIVVIGVFYVRSERRCWCGLSEI"
     MPTYPHSRTT ETPQIACQAH YGLIGSVAQA LNHYTVRPRC KEIVSFNHTF PADLGDGSSP        60
     FDARNIDNAG DAEIRKHQAC PHRRLFRLLE ACGEWQPRFG SKVQSTHGMS EAGFFAVPDP       120
     NEPVQDANMG IFVPNVEAKF LDESSDVLSL NEEGVYICTP FVRKGYLDEP THTAQAARPV       180
     TRSEIETAVS RHPGVRDVAV IPVVLPGSEC PAPRAYIVKT YGSSLLIEEL ISCMATKYLP       240
     RMQLTGGAAF VDAIEQIWVH GWGHRIEVQI PSLLQIEASI IPIVVIGVFY VRSERRCWCG       300
     LSEI                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page