(data stored in ACNUC16935 zone)

EMBL: BN001307.PE128

BN001307.PE128       Location/Qualifiers
FT   CDS             complement(join(359067..359575,359637..359701,
FT                   359770..360167,360248..360352,360408..360584))
FT                   /locus_tag="ANIA_08943"
FT                   /old_locus_tag="AN8943.4"
FT                   /product="integral membrane protein, putative
FT                   (AFU_orthologue; AFUA_6G11560)"
FT                   /note="transcript_id=CADANIAT00007919"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007919"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007919"
FT                   /db_xref="GOA:Q5ARY7"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY7"
FT                   /protein_id="CBF84606.1"
FT                   /translation="MSSGLNSDDSDGHVRELAVRSVAASFLSIATIAVSLRCYVRGWLI
FT                   KGFGWDDWAMVVAMAFYIMFSACMIGGSIYGTGHRFAALEPQNRVTAMRYWWLCEIAYC
FT                   FSSVGCKISVCIFLMRITIKRIHIWILYIVMALTVLTGLVFMFIMLLQCKPLEYFWTRT
FT                   AFDPDVKGYCIDIQIVIAMTYVYSAFAALCDFTVGTLPIFLVSKLQMRKKTKLAVVGIL
FT                   SMACIASSAVIVRIPFVKTFADPDFLYATIEIAIWSNIEIGLGITAGSLATLRPLLRHW
FT                   MGSTNDPSYPLGTPSPFPGRSGSRLPGASGRDRAYPLGSMDDSNRLRPDKLALTVTTVQ
FT                   TQHDPEDRWPVLPDGNSSEERLTNEHQRNGKGNGNRTPTRSSAERNVMGSGFGGIHQVI
FT                   EVTQTSTDLRSTSVKEHV"
     MSSGLNSDDS DGHVRELAVR SVAASFLSIA TIAVSLRCYV RGWLIKGFGW DDWAMVVAMA        60
     FYIMFSACMI GGSIYGTGHR FAALEPQNRV TAMRYWWLCE IAYCFSSVGC KISVCIFLMR       120
     ITIKRIHIWI LYIVMALTVL TGLVFMFIML LQCKPLEYFW TRTAFDPDVK GYCIDIQIVI       180
     AMTYVYSAFA ALCDFTVGTL PIFLVSKLQM RKKTKLAVVG ILSMACIASS AVIVRIPFVK       240
     TFADPDFLYA TIEIAIWSNI EIGLGITAGS LATLRPLLRH WMGSTNDPSY PLGTPSPFPG       300
     RSGSRLPGAS GRDRAYPLGS MDDSNRLRPD KLALTVTTVQ TQHDPEDRWP VLPDGNSSEE       360
     RLTNEHQRNG KGNGNRTPTR SSAERNVMGS GFGGIHQVIE VTQTSTDLRS TSVKEHV          417
//

If you have problems or comments...

PBIL Back to PBIL home page