(data stored in ACNUC16935 zone)

EMBL: BN001307.PE129

BN001307.PE129       Location/Qualifiers
FT   CDS             join(364679..365405,365445..365533)
FT                   /locus_tag="ANIA_08942"
FT                   /old_locus_tag="AN8942.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007920"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007920"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007920"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARY8"
FT                   /protein_id="CBF84608.1"
FT                   /translation="MATPPASITFYDIAMRTPSLSCSPNPSKTRLALNFASVPYKTTFV
FT                   PLPSIPSVRQSLGVPAGRQFADGSDFYTLPVIVDEVTGSKIGDSFDIAIYLHERYADAN
FT                   GGKGELFPILKNGEKLDFRTPNTAMLVPLSAMSEVARQDKYLEYATFNTHVDAAFTLHV
FT                   LLTVHGLPFPPDTAEATRAEFCKRAGVPSWDAFTVSGEAREKLKESLKETLAELAKLFV
FT                   RNEDGPFILGGKPCYADFIVDEWEEVRGWHGGVFGRVFDALSVYMEVKE"
     MATPPASITF YDIAMRTPSL SCSPNPSKTR LALNFASVPY KTTFVPLPSI PSVRQSLGVP        60
     AGRQFADGSD FYTLPVIVDE VTGSKIGDSF DIAIYLHERY ADANGGKGEL FPILKNGEKL       120
     DFRTPNTAML VPLSAMSEVA RQDKYLEYAT FNTHVDAAFT LHVLLTVHGL PFPPDTAEAT       180
     RAEFCKRAGV PSWDAFTVSG EAREKLKESL KETLAELAKL FVRNEDGPFI LGGKPCYADF       240
     IVDEWEEVRG WHGGVFGRVF DALSVYMEVK E                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page