(data stored in ACNUC16935 zone)

EMBL: BN001307.PE13

BN001307.PE13        Location/Qualifiers
FT   CDS             complement(join(39033..39247,39301..39415,39464..39665,
FT                   39727..40420,40535..40731,40779..41414,41463..42587,
FT                   42654..42779,42998..43017))
FT                   /locus_tag="ANIA_09048"
FT                   /old_locus_tag="AN9048.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007805"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007805"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007805"
FT                   /db_xref="GOA:Q5ARN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN2"
FT                   /protein_id="CBF84393.1"
FT                   /translation="MALALEDSLWNPTVLSPELILSMQEYLSPALRQPPLPDSEKKRLR
FT                   ELSRYYCAIRPSSVPQDPDATLTQSEPENEPGLNVAQLPSDITLTALTQLGVHRLGCER
FT                   SFASLIDGHSQYIISEATASISLRDREKHSPNDGLYLGNTTLDLVWGVCPHAIKLFSGY
FT                   DVPHLKNTANVTANPTRYIVRDFTQEDCFKDRPYVTGWPHMRFYAEVPIYSPSGHILGG
FT                   YCVVDNKPRQDFSEDEVIALQEISDAIARHLENVRTVHYHRRSDRLIQGLTTFVKDRLH
FT                   ERSPLDAPAPPRAAETPSLERLGLDELPSSTEVTGGTSLLFSTQNAARKSTHATSLSGT
FT                   LHKAVSSPLLNEVVTDTGPSQDTVPLRMNDNSSAKSTPKPVAKDKVPFLRRIENIYAYA
FT                   SSLIRESMDLDGVMFVDASRCNSGSVSLKADMLNWEPLPKNADPRPRSQYSNSAVADET
FT                   ICDTLGLASNETDTQHGIPDSLLRELIAAFPQGGVLLPDADNDNSQLPETRLAKSFPEA
FT                   KSLLFIPLWDWNKGQWLAGTFVWTKDSEQERALGVDELHYFKVFGDSIISEIARLDWSL
FT                   KEKSKFGLISSVSHEIRSPLHGMLANAELLSSSPLQPEQQQTVKALEMCGITLLDTMNH
FT                   LLDFAKINNLASINQTASSVTSLLTSFDLDVLIEEVVSSVFSGMCHAAIALTPPESPSN
FT                   PDTAYKQDSGFVEISVSLLDPPVKTDPDSAVAHLRFTDTGCGMSQEFLRNKLYSPFAQE
FT                   DALAEGAGLGLSIVKQLVSFFKGSIDVKSEIDVGTQVDIQIPVQLAPDDFATGAFGPEL
FT                   GMGLRETTFSLIGLDAYPELSEEPTGSLSSEAKRRICLQSFFTNLLSGKPNWKISSTAT
FT                   LAEADGEIAIVSEAALKQLFVDESLRRRAEKNQTKFVCLCDGLPTLNANGPGGAQVIRL
FT                   YQPYSPRKVLQAIESVMQAKPQPFAGADDQSPPVSKATPPTNPTNDSAPPASGTHGNKV
FT                   LIVDDNEINLKVLARLMSKLGYQHTTATNGLVAFTKYKESPNSFSMVLMDISMPVMDGI
FT                   DATRNIRSYEWEKQLSSVKVFAVTGIGSAAMQHEALMAGVDEYLVKPLSLGQLGKLMKV
FT                   HL"
     MALALEDSLW NPTVLSPELI LSMQEYLSPA LRQPPLPDSE KKRLRELSRY YCAIRPSSVP        60
     QDPDATLTQS EPENEPGLNV AQLPSDITLT ALTQLGVHRL GCERSFASLI DGHSQYIISE       120
     ATASISLRDR EKHSPNDGLY LGNTTLDLVW GVCPHAIKLF SGYDVPHLKN TANVTANPTR       180
     YIVRDFTQED CFKDRPYVTG WPHMRFYAEV PIYSPSGHIL GGYCVVDNKP RQDFSEDEVI       240
     ALQEISDAIA RHLENVRTVH YHRRSDRLIQ GLTTFVKDRL HERSPLDAPA PPRAAETPSL       300
     ERLGLDELPS STEVTGGTSL LFSTQNAARK STHATSLSGT LHKAVSSPLL NEVVTDTGPS       360
     QDTVPLRMND NSSAKSTPKP VAKDKVPFLR RIENIYAYAS SLIRESMDLD GVMFVDASRC       420
     NSGSVSLKAD MLNWEPLPKN ADPRPRSQYS NSAVADETIC DTLGLASNET DTQHGIPDSL       480
     LRELIAAFPQ GGVLLPDADN DNSQLPETRL AKSFPEAKSL LFIPLWDWNK GQWLAGTFVW       540
     TKDSEQERAL GVDELHYFKV FGDSIISEIA RLDWSLKEKS KFGLISSVSH EIRSPLHGML       600
     ANAELLSSSP LQPEQQQTVK ALEMCGITLL DTMNHLLDFA KINNLASINQ TASSVTSLLT       660
     SFDLDVLIEE VVSSVFSGMC HAAIALTPPE SPSNPDTAYK QDSGFVEISV SLLDPPVKTD       720
     PDSAVAHLRF TDTGCGMSQE FLRNKLYSPF AQEDALAEGA GLGLSIVKQL VSFFKGSIDV       780
     KSEIDVGTQV DIQIPVQLAP DDFATGAFGP ELGMGLRETT FSLIGLDAYP ELSEEPTGSL       840
     SSEAKRRICL QSFFTNLLSG KPNWKISSTA TLAEADGEIA IVSEAALKQL FVDESLRRRA       900
     EKNQTKFVCL CDGLPTLNAN GPGGAQVIRL YQPYSPRKVL QAIESVMQAK PQPFAGADDQ       960
     SPPVSKATPP TNPTNDSAPP ASGTHGNKVL IVDDNEINLK VLARLMSKLG YQHTTATNGL      1020
     VAFTKYKESP NSFSMVLMDI SMPVMDGIDA TRNIRSYEWE KQLSSVKVFA VTGIGSAAMQ      1080
     HEALMAGVDE YLVKPLSLGQ LGKLMKVHL                                        1109
//

If you have problems or comments...

PBIL Back to PBIL home page