(data stored in ACNUC16935 zone)

EMBL: BN001307.PE131

BN001307.PE131       Location/Qualifiers
FT   CDS             371651..373759
FT                   /locus_tag="ANIA_08940"
FT                   /old_locus_tag="AN8940.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007922"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007922"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007922"
FT                   /db_xref="GOA:Q5ARZ0"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ0"
FT                   /protein_id="CBF84611.1"
FT                   /translation="MANQESSTLVGCLFDVSGSMRKLLKTGQPDGRAVDRFHAVLGAAL
FT                   DIARKEQQSDPRAKMFVGAFGLDRQDGYPPTVDLCGIVEALLEENDQDDRSGHDSLIEI
FT                   ANQNNLAHITEYIRNKLTDSVARIVHACLRRCPERIHEFKDAIPSAAEIRKSQTMKNGA
FT                   TFGGGAVAIGVGSLVCGPLGGLLGAALTAGGAMSADAYADEVVDSSEGLMLARRICREW
FT                   FRDFADFIPRPVSDVVRLLQLLQQRSTRARQWLSVEEFVYGDTPMREALSRSLSVFQAN
FT                   SDCDQRVLVLMSDGHATDGDPGEIATELHSEGVAVASVYLTSDTDIAQRRLYDKPAYSW
FT                   DKGQRTLFNIASKVSASNHPIPVLMSVGWQIPCSGEVALYVCVCTEPAVEEFCSLLVSA
FT                   HLASTDALLDVIGRLQLDDYIQDELAITCKNPSDQGSSATCYAHAIAAVIHMALLRIER
FT                   KEPCPTIKEIRDRILHEFPPGDHGRVAEEVLNQAVQWYRLRYRAVDEMRARQAVLQRRP
FT                   VLTTFRLSEKGWAKFSQYFSQPQTRRSMLTEANMRPYRQGPDGGGHAVVLYACDPRSLS
FT                   FLNSWGSDWGTNGGFRVQSPAVLEIDEPDCLSPVHFYDVFWYESDLTPSERAAYDAKAE
FT                   EKLRAYTTYHPSLLELEAMCPLCQRISLISDFTGNAREAKCPRCLFSFVPQPGSLLQVL
FT                   YARAGLGT"
     MANQESSTLV GCLFDVSGSM RKLLKTGQPD GRAVDRFHAV LGAALDIARK EQQSDPRAKM        60
     FVGAFGLDRQ DGYPPTVDLC GIVEALLEEN DQDDRSGHDS LIEIANQNNL AHITEYIRNK       120
     LTDSVARIVH ACLRRCPERI HEFKDAIPSA AEIRKSQTMK NGATFGGGAV AIGVGSLVCG       180
     PLGGLLGAAL TAGGAMSADA YADEVVDSSE GLMLARRICR EWFRDFADFI PRPVSDVVRL       240
     LQLLQQRSTR ARQWLSVEEF VYGDTPMREA LSRSLSVFQA NSDCDQRVLV LMSDGHATDG       300
     DPGEIATELH SEGVAVASVY LTSDTDIAQR RLYDKPAYSW DKGQRTLFNI ASKVSASNHP       360
     IPVLMSVGWQ IPCSGEVALY VCVCTEPAVE EFCSLLVSAH LASTDALLDV IGRLQLDDYI       420
     QDELAITCKN PSDQGSSATC YAHAIAAVIH MALLRIERKE PCPTIKEIRD RILHEFPPGD       480
     HGRVAEEVLN QAVQWYRLRY RAVDEMRARQ AVLQRRPVLT TFRLSEKGWA KFSQYFSQPQ       540
     TRRSMLTEAN MRPYRQGPDG GGHAVVLYAC DPRSLSFLNS WGSDWGTNGG FRVQSPAVLE       600
     IDEPDCLSPV HFYDVFWYES DLTPSERAAY DAKAEEKLRA YTTYHPSLLE LEAMCPLCQR       660
     ISLISDFTGN AREAKCPRCL FSFVPQPGSL LQVLYARAGL GT                          702
//

If you have problems or comments...

PBIL Back to PBIL home page