(data stored in ACNUC16935 zone)

EMBL: BN001307.PE132

BN001307.PE132       Location/Qualifiers
FT   CDS             join(375270..375462,375543..376420)
FT                   /locus_tag="ANIA_08939"
FT                   /old_locus_tag="AN8939.4"
FT                   /product="PHD finger protein (AFU_orthologue;
FT                   AFUA_6G13765)"
FT                   /note="transcript_id=CADANIAT00007923"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007923"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007923"
FT                   /db_xref="GOA:Q5ARZ1"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ1"
FT                   /protein_id="CBF84613.1"
FT                   /translation="MPSRKGQPRTLAKATGAERRQRTRRSLPVIPATPQAEPETWERTV
FT                   AEIAQEPMDLHVKKYREWKRNGSPHDTACRVCGATGNSDLKPGRLINCHTCRVAFHFIC
FT                   VPDGSEWATREGLYCPICVKRGWDMSPPGLSPPTSPVPAPAPIERPKGVAPIESAVTAA
FT                   VPREGPNTDSTNGPKPPQAASEGASFGNSSERIPQSPAVTARAESMRHDEDNNSDPEAP
FT                   QPKRQRTSRFVTLPSDVDASLGVIYRELESVASLKLQIQELQYKDRQSAQMIKLRDNSI
FT                   AILRRDLEKYRADDSELARLRDSAARFDQVKREMEELKRKNEMLGAELRKSREETATAQ
FT                   SLVNDWKGKLAQLLNA"
     MPSRKGQPRT LAKATGAERR QRTRRSLPVI PATPQAEPET WERTVAEIAQ EPMDLHVKKY        60
     REWKRNGSPH DTACRVCGAT GNSDLKPGRL INCHTCRVAF HFICVPDGSE WATREGLYCP       120
     ICVKRGWDMS PPGLSPPTSP VPAPAPIERP KGVAPIESAV TAAVPREGPN TDSTNGPKPP       180
     QAASEGASFG NSSERIPQSP AVTARAESMR HDEDNNSDPE APQPKRQRTS RFVTLPSDVD       240
     ASLGVIYREL ESVASLKLQI QELQYKDRQS AQMIKLRDNS IAILRRDLEK YRADDSELAR       300
     LRDSAARFDQ VKREMEELKR KNEMLGAELR KSREETATAQ SLVNDWKGKL AQLLNA           356
//

If you have problems or comments...

PBIL Back to PBIL home page