(data stored in ACNUC16935 zone)

EMBL: BN001307.PE134

BN001307.PE134       Location/Qualifiers
FT   CDS             complement(join(379530..379554,379593..379636,
FT                   379666..380160))
FT                   /locus_tag="ANIA_08937"
FT                   /old_locus_tag="AN8937.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007925"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007925"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007925"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ3"
FT                   /protein_id="CBF84617.1"
FT                   /translation="MPQENGTNNGTPAFLSTQPGPNHDWRITLKDKVIVITGANRGIGL
FT                   AIAEVCLANEAAAVYSLDLFEPGEEFTAVQKKSANPSRLQYIHCDVTSEESISSAIDAV
FT                   VSASGAVHGFVANAGMTKHQPALDFTRAEIDKLFNLNVFGAYFCATAVARKFIELGIKG
FT                   SITQPRSAERTLWRYEGGRTMVFA"
     MPQENGTNNG TPAFLSTQPG PNHDWRITLK DKVIVITGAN RGIGLAIAEV CLANEAAAVY        60
     SLDLFEPGEE FTAVQKKSAN PSRLQYIHCD VTSEESISSA IDAVVSASGA VHGFVANAGM       120
     TKHQPALDFT RAEIDKLFNL NVFGAYFCAT AVARKFIELG IKGSITQPRS AERTLWRYEG       180
     GRTMVFA                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page