(data stored in ACNUC16935 zone)

EMBL: BN001307.PE135

BN001307.PE135       Location/Qualifiers
FT   CDS             join(380593..380851,380897..381480,381526..381615,
FT                   381685..382104,382279..382323)
FT                   /locus_tag="ANIA_08936"
FT                   /old_locus_tag="AN8936.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007926"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007926"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007926"
FT                   /db_xref="GOA:Q5ARZ4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ4"
FT                   /protein_id="CBF84619.1"
FT                   /translation="MDAKDLDEYHNGESNHIEASQEIFWTEEEEEKLVRKIDLFLLPNI
FT                   WIMYLLSYMDRTNIGNAKVAGMSDDLGLTSSQYSIVLVVFFIGYVVFEPPSNMILVRSR
FT                   PSLYLPAIMCLWGILTCVMSVVQHYHHLIVLRVFIGIVEAGFAPGILLIISSWYKRKEQ
FT                   SRRFAVFISAAILSGAFGGLIAGGITDGLEGVHGIRGWRWLFIVEGAATAGWAIISKFL
FT                   LLDYPGTSKRLTEREKAIAAARLQEGVIARGADERIGKLQGFCMACKDWRTWGFTIGYM
FT                   VIVGSSTLTYFYPTLVSGLGYTGRMAQYMTVPIYAVAFACTMITSVISDKLPTYRGLII
FT                   ASWLTVSMVTSIIVCAVYDFTTRYALLVIMAAGLWVSNATSLSFASSSFGSMDPEVRAQ
FT                   SLALMNALGNLAQIYGAYLFPSDDEPKYLMGFGVISGMLGVGVATYILMFALCRETVFA
FT                   ISDYLVR"
     MDAKDLDEYH NGESNHIEAS QEIFWTEEEE EKLVRKIDLF LLPNIWIMYL LSYMDRTNIG        60
     NAKVAGMSDD LGLTSSQYSI VLVVFFIGYV VFEPPSNMIL VRSRPSLYLP AIMCLWGILT       120
     CVMSVVQHYH HLIVLRVFIG IVEAGFAPGI LLIISSWYKR KEQSRRFAVF ISAAILSGAF       180
     GGLIAGGITD GLEGVHGIRG WRWLFIVEGA ATAGWAIISK FLLLDYPGTS KRLTEREKAI       240
     AAARLQEGVI ARGADERIGK LQGFCMACKD WRTWGFTIGY MVIVGSSTLT YFYPTLVSGL       300
     GYTGRMAQYM TVPIYAVAFA CTMITSVISD KLPTYRGLII ASWLTVSMVT SIIVCAVYDF       360
     TTRYALLVIM AAGLWVSNAT SLSFASSSFG SMDPEVRAQS LALMNALGNL AQIYGAYLFP       420
     SDDEPKYLMG FGVISGMLGV GVATYILMFA LCRETVFAIS DYLVR                       465
//

If you have problems or comments...

PBIL Back to PBIL home page