(data stored in ACNUC16935 zone)

EMBL: BN001307.PE136

BN001307.PE136       Location/Qualifiers
FT   CDS             complement(join(383271..384292,384362..384712,
FT                   384765..385247,385315..385424,385487..385680))
FT                   /locus_tag="ANIA_08935"
FT                   /old_locus_tag="AN8935.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007927"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007927"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007927"
FT                   /db_xref="GOA:Q5ARZ5"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ5"
FT                   /protein_id="CBF84621.1"
FT                   /translation="MAPGLELLPKTTALPTKAANAINNAVYGRDSDVKFESAEKHQRVL
FT                   NVFRAFIADLVQQYGDGHPGAPMGMAAIGIALWKYVMKYSPTNCNYFNRDRFVLSNGHA
FT                   CLWQYLFMHLVGVKSMTLEQLKSYHSTDSSSLCPGHPEIENEGVEVTTGPLGQGVANAV
FT                   GLAMATKNLAATYNKPGYEVVNNMTWCMVGDACLQEGVGLEALSLAGHWRLNNLCVIFD
FT                   NNNVTCDGTADVANTEDINTKMRATGFKVIDVYDGDSDVVAITNALLAARSSTKPTFIN
FT                   IRTTIGVGSKQAGTADAHGAALGVDEVAKIKRAFGLNPEEHFHIPQDVYDFFSDLPSRG
FT                   KTHEAEWHAAVAAYREAEPVLASEFDLRVAGKMPADWTKYKLGQNVKNFLVGTADLTPS
FT                   VNVAYKNKVDFQSPDLKTACGMSGNYAGRYIHYGIREHAMCAISNGLAAFNKGTFIPIT
FT                   STYLVFHLYAAAAVRMAALQGLHQIHIATHDSIGVGENGPTHQPIAVPALYRAMPNILF
FT                   IRPCDAEETVGAYIAAIQHDTTPSVLALSRQNLTQYPAHSSREGVQKGAYVFVEEENFD
FT                   VTLLSVGSEMAYTMAAREILAAEHGIKARVVSFPCARLFELQSREYKHSVLKPRAGKPA
FT                   VAIEAYPSVGWERYADAAIAQNQFGKSLPCKEVYEHFGFSGKIIADKVKGLVDEVRRDG
FT                   VEVLRGDFRDLNGGPSVGVEHPNVP"
     MAPGLELLPK TTALPTKAAN AINNAVYGRD SDVKFESAEK HQRVLNVFRA FIADLVQQYG        60
     DGHPGAPMGM AAIGIALWKY VMKYSPTNCN YFNRDRFVLS NGHACLWQYL FMHLVGVKSM       120
     TLEQLKSYHS TDSSSLCPGH PEIENEGVEV TTGPLGQGVA NAVGLAMATK NLAATYNKPG       180
     YEVVNNMTWC MVGDACLQEG VGLEALSLAG HWRLNNLCVI FDNNNVTCDG TADVANTEDI       240
     NTKMRATGFK VIDVYDGDSD VVAITNALLA ARSSTKPTFI NIRTTIGVGS KQAGTADAHG       300
     AALGVDEVAK IKRAFGLNPE EHFHIPQDVY DFFSDLPSRG KTHEAEWHAA VAAYREAEPV       360
     LASEFDLRVA GKMPADWTKY KLGQNVKNFL VGTADLTPSV NVAYKNKVDF QSPDLKTACG       420
     MSGNYAGRYI HYGIREHAMC AISNGLAAFN KGTFIPITST YLVFHLYAAA AVRMAALQGL       480
     HQIHIATHDS IGVGENGPTH QPIAVPALYR AMPNILFIRP CDAEETVGAY IAAIQHDTTP       540
     SVLALSRQNL TQYPAHSSRE GVQKGAYVFV EEENFDVTLL SVGSEMAYTM AAREILAAEH       600
     GIKARVVSFP CARLFELQSR EYKHSVLKPR AGKPAVAIEA YPSVGWERYA DAAIAQNQFG       660
     KSLPCKEVYE HFGFSGKIIA DKVKGLVDEV RRDGVEVLRG DFRDLNGGPS VGVEHPNVP        719
//

If you have problems or comments...

PBIL Back to PBIL home page