(data stored in ACNUC16935 zone)

EMBL: BN001307.PE137

BN001307.PE137       Location/Qualifiers
FT   CDS             387229..388527
FT                   /locus_tag="ANIA_08934"
FT                   /old_locus_tag="AN8934.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007928"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007928"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007928"
FT                   /db_xref="GOA:Q5ARZ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ6"
FT                   /protein_id="CBF84623.1"
FT                   /translation="MDSAEKDLEGGSSSFCIDQSTTTTSPVSEKSVPPPPDHGLRAWLQ
FT                   VLCMHLVFLNTWGVSNGFSIFNQLYTKTLPESSSTISWIGSIQISLLFFFGVFAGRATD
FT                   AGYFRLMYMAGAFFQVFGFFMLSLCKDYWQIFLAQGICMGISNGLTFGPGLAVTSSYFS
FT                   RNRGLAVGIAAAGATTGGMIYPVLIHQLLDIHSLSFGWTVRIAAFVMLITQISGLLFFH
FT                   PRLPPRPSGPFLDSAAFKEKPFVFFALSMFLNLWGLYFAFFYMGTFARDRLAVRDTQNF
FT                   ILIQNGVGVLGRILPTRLADRVTGKFNILIPLNFTAAVVVYAWIAVHTVAGLYVFTVIY
FT                   GLAGGAAQSLFPATATTMITDVRKTGTRIGMILSFVGIATLTGPAIDGALIQAMQGEYT
FT                   GAQVFSGTCIVLRAGSALAARVAKTGWKLRVVV"
     MDSAEKDLEG GSSSFCIDQS TTTTSPVSEK SVPPPPDHGL RAWLQVLCMH LVFLNTWGVS        60
     NGFSIFNQLY TKTLPESSST ISWIGSIQIS LLFFFGVFAG RATDAGYFRL MYMAGAFFQV       120
     FGFFMLSLCK DYWQIFLAQG ICMGISNGLT FGPGLAVTSS YFSRNRGLAV GIAAAGATTG       180
     GMIYPVLIHQ LLDIHSLSFG WTVRIAAFVM LITQISGLLF FHPRLPPRPS GPFLDSAAFK       240
     EKPFVFFALS MFLNLWGLYF AFFYMGTFAR DRLAVRDTQN FILIQNGVGV LGRILPTRLA       300
     DRVTGKFNIL IPLNFTAAVV VYAWIAVHTV AGLYVFTVIY GLAGGAAQSL FPATATTMIT       360
     DVRKTGTRIG MILSFVGIAT LTGPAIDGAL IQAMQGEYTG AQVFSGTCIV LRAGSALAAR       420
     VAKTGWKLRV VV                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page