(data stored in ACNUC16935 zone)

EMBL: BN001307.PE138

BN001307.PE138       Location/Qualifiers
FT   CDS             join(389081..389919,390104..390153,390240..390364,
FT                   390520..390627)
FT                   /locus_tag="ANIA_08933"
FT                   /old_locus_tag="AN8933.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007929"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007929"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007929"
FT                   /db_xref="GOA:Q5ARZ7"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ7"
FT                   /protein_id="CBF84624.1"
FT                   /translation="MPSNLPLDIARTLAEHISVEPVGPETFQARFNPERQGNTASYSYG
FT                   GCALGVGVQAACQTAPDGYNLYSVTGSFLAPVLTDSKITCSVRRLRDTRTFATRQVEIS
FT                   QVQNATTRLCVIMLADFHKKEKDSLLEYSSPPDHIYSKPESCLTPQETGQKKVEQGTIS
FT                   IESLSLYNTLFGLIARFFEARQAPEGISAHNLHGMVKEQPQPPHQARLPLTAKTSADWF
FT                   RCRTPLSAKSDHYAGLAWMLDAYLTFTPLAHSGMFLDDAAACATLDFAIRFFCDEFDLI
FT                   TVRVYLLPDRALNRTEYIGDLCLMVYRSNRVSNLRATFGGYMRGDRHTPKASPVEQKND
FT                   PGAEVQGIPETYENALAYYAAAIEIRYSSHAIL"
     MPSNLPLDIA RTLAEHISVE PVGPETFQAR FNPERQGNTA SYSYGGCALG VGVQAACQTA        60
     PDGYNLYSVT GSFLAPVLTD SKITCSVRRL RDTRTFATRQ VEISQVQNAT TRLCVIMLAD       120
     FHKKEKDSLL EYSSPPDHIY SKPESCLTPQ ETGQKKVEQG TISIESLSLY NTLFGLIARF       180
     FEARQAPEGI SAHNLHGMVK EQPQPPHQAR LPLTAKTSAD WFRCRTPLSA KSDHYAGLAW       240
     MLDAYLTFTP LAHSGMFLDD AAACATLDFA IRFFCDEFDL ITVRVYLLPD RALNRTEYIG       300
     DLCLMVYRSN RVSNLRATFG GYMRGDRHTP KASPVEQKND PGAEVQGIPE TYENALAYYA       360
     AAIEIRYSSH AIL                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page