(data stored in ACNUC16935 zone)

EMBL: BN001307.PE139

BN001307.PE139       Location/Qualifiers
FT   CDS             complement(join(391467..392218,392274..392361))
FT                   /locus_tag="ANIA_08932"
FT                   /old_locus_tag="AN8932.4"
FT                   /product="TIM-barrel enzyme family protein (AFU_orthologue;
FT                   AFUA_1G10110)"
FT                   /note="transcript_id=CADANIAT00007930"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007930"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007930"
FT                   /db_xref="GOA:C8VLH6"
FT                   /db_xref="InterPro:IPR009215"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLH6"
FT                   /protein_id="CBF84626.1"
FT                   /translation="MAPPTSRPEILSRLRAQIQAGKPIVGAGAGIGLSAKSVEAGGGDL
FT                   IIIYNSGRFRMAGHGSLAGLMPYSNANEVVVEMASEVLPVVKHTPVIAGVCGTDPLRDI
FT                   PRFLSQLKGMGFAGVQNFPTVGLIDGQFRANLEETGMGYDKEVEMVRAASELGLLTTPY
FT                   VFNVGEAEAMAKAGADILVAHMGLTTSGTIGAKTGKTLEQCVDEIQAIRDVAVKINPDV
FT                   ILLCHGGPIARPEDARFILGRVAGLHGFYGASSMERLPVEVAIKDTTAEFKKIALRH"
     MAPPTSRPEI LSRLRAQIQA GKPIVGAGAG IGLSAKSVEA GGGDLIIIYN SGRFRMAGHG        60
     SLAGLMPYSN ANEVVVEMAS EVLPVVKHTP VIAGVCGTDP LRDIPRFLSQ LKGMGFAGVQ       120
     NFPTVGLIDG QFRANLEETG MGYDKEVEMV RAASELGLLT TPYVFNVGEA EAMAKAGADI       180
     LVAHMGLTTS GTIGAKTGKT LEQCVDEIQA IRDVAVKINP DVILLCHGGP IARPEDARFI       240
     LGRVAGLHGF YGASSMERLP VEVAIKDTTA EFKKIALRH                              279
//

If you have problems or comments...

PBIL Back to PBIL home page