(data stored in ACNUC16935 zone)

EMBL: BN001307.PE140

BN001307.PE140       Location/Qualifiers
FT   CDS             392626..393954
FT                   /locus_tag="ANIA_08931"
FT                   /old_locus_tag="AN8931.4"
FT                   /product="UPF0261 domain protein (AFU_orthologue;
FT                   AFUA_1G10120)"
FT                   /note="transcript_id=CADANIAT00007931"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007931"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007931"
FT                   /db_xref="GOA:Q5ARZ9"
FT                   /db_xref="InterPro:IPR008322"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARZ9"
FT                   /protein_id="CBF84628.1"
FT                   /translation="MHLILLGTLDTKRSEVLYLHSQLHQTASRLNTPLSITLIDCGVRS
FT                   EIDSDPAITVSHTDLITKYPYASDLDSPSPTKDLFVLPRGEAISIITACATKCVSELLQ
FT                   TQDVHGIIGVGGSGGTSLISAVMRSAAKIGLPKLIVSTVASGNTGPIVGETDLTLMYSV
FT                   VDIAGSNRLLKDVLENAAGAMVGMASAYKARLEASISATPAQSEKSRLRVGVTMFGVTT
FT                   PCVDTIRSHLETNYAVEVYVFHATGHGGKAMERLVEEGHLDAMLDLTTTEICDLIAGGE
FT                   MACDRRRLETSLKKGIPTIISVGATDMVNFGPIETVPPKYQGRKLFVHNPSVTLMRTSR
FT                   EECEAVGRFIVEKVNGCVREGKAGLVEVVIPKGGVSKISTTGGVFEDKQADEALANVLM
FT                   VGLEGKVRVVQDPRDVNDRGFAVDIAERLMTLVAAAGEKREKV"
     MHLILLGTLD TKRSEVLYLH SQLHQTASRL NTPLSITLID CGVRSEIDSD PAITVSHTDL        60
     ITKYPYASDL DSPSPTKDLF VLPRGEAISI ITACATKCVS ELLQTQDVHG IIGVGGSGGT       120
     SLISAVMRSA AKIGLPKLIV STVASGNTGP IVGETDLTLM YSVVDIAGSN RLLKDVLENA       180
     AGAMVGMASA YKARLEASIS ATPAQSEKSR LRVGVTMFGV TTPCVDTIRS HLETNYAVEV       240
     YVFHATGHGG KAMERLVEEG HLDAMLDLTT TEICDLIAGG EMACDRRRLE TSLKKGIPTI       300
     ISVGATDMVN FGPIETVPPK YQGRKLFVHN PSVTLMRTSR EECEAVGRFI VEKVNGCVRE       360
     GKAGLVEVVI PKGGVSKIST TGGVFEDKQA DEALANVLMV GLEGKVRVVQ DPRDVNDRGF       420
     AVDIAERLMT LVAAAGEKRE KV                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page