(data stored in ACNUC16935 zone)

EMBL: BN001307.PE142

BN001307.PE142       Location/Qualifiers
FT   CDS             join(397530..398256,398328..398938)
FT                   /locus_tag="ANIA_11151"
FT                   /old_locus_tag="AN11151.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007933"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007933"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007933"
FT                   /db_xref="GOA:C8VLH9"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLH9"
FT                   /protein_id="CBF84632.1"
FT                   /translation="MIFLWLLLLAYRVTAKLFEAPNPWEEASQVIVSNVTLDSNPVSNS
FT                   SVPSIDHNTRQNTEYVRLQSRLDRTSGTWGASHPRHRLLMALYGFSRYKERSSAEVKRW
FT                   RDLYKHVPKSQKQLVERVIGYTRKLNTVEHLYDHNDVLAGDIVRFGMEFYGIEQTELDV
FT                   FIQDMEKEKKGADRTSVVQAMKHFVRDWSDEGLFEREGAFRCILDSISGIERGGEERPV
FT                   SVLVPGAGAGRLGYEIDALGGFEVTINEWSAYMNLIHRYVVQINAPESLVYHPYIDWWS
FT                   HHATTSDMQRGVSFPDSIPRPSSKASIVMIEGDFTTIFEDADSSTYDIIVTLFFIDTAR
FT                   NLLNYLETIYRLLKPGGRWINLGPLLYGTGPWLQLSLDEIVKLSEALGFEFEVDVSDQA
FT                   GIVCGTLTQGEGLGGKVRSMYVPYGQNKRGLSRNAYDAQFWRARKR"
     MIFLWLLLLA YRVTAKLFEA PNPWEEASQV IVSNVTLDSN PVSNSSVPSI DHNTRQNTEY        60
     VRLQSRLDRT SGTWGASHPR HRLLMALYGF SRYKERSSAE VKRWRDLYKH VPKSQKQLVE       120
     RVIGYTRKLN TVEHLYDHND VLAGDIVRFG MEFYGIEQTE LDVFIQDMEK EKKGADRTSV       180
     VQAMKHFVRD WSDEGLFERE GAFRCILDSI SGIERGGEER PVSVLVPGAG AGRLGYEIDA       240
     LGGFEVTINE WSAYMNLIHR YVVQINAPES LVYHPYIDWW SHHATTSDMQ RGVSFPDSIP       300
     RPSSKASIVM IEGDFTTIFE DADSSTYDII VTLFFIDTAR NLLNYLETIY RLLKPGGRWI       360
     NLGPLLYGTG PWLQLSLDEI VKLSEALGFE FEVDVSDQAG IVCGTLTQGE GLGGKVRSMY       420
     VPYGQNKRGL SRNAYDAQFW RARKR                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page