(data stored in ACNUC16935 zone)

EMBL: BN001307.PE143

BN001307.PE143       Location/Qualifiers
FT   CDS             join(399381..399557,399620..399728,399789..399938,
FT                   399994..400670,400732..400883,400965..401163)
FT                   /locus_tag="ANIA_11153"
FT                   /old_locus_tag="AN11153.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007934"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007934"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007934"
FT                   /db_xref="GOA:C8VLI0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI0"
FT                   /protein_id="CBF84634.1"
FT                   /translation="MDSKEQDNNLNHDNPTLNDIFEEHEPTSDTSLLRRIDVRILPIMF
FT                   LAYFLQFLDKVCLNYANVMGIQDELSMSGNDFSWLATAFFIAYAVAEVPQGYLLQKYPV
FT                   TKVLAANIFIWGVMLCCSAAVQNYAGLLALRVLLGTAEAVIAPALTIYTSMWYTPAEAS
FT                   PRFGLWYCGLGTGQILGGLISFGAQHASSSQSFSGWRIMFLVIGFANIAVSLLVLVVLP
FT                   VSPETASFLSPDAKTRIFHRLKSAVTGGLGNKTFHAPSVLTTLGDPQTWLLCLLTILVT
FT                   IPSGLIVTFSSILIKGFGYTSKESALLNMPSGVVSILSILLSTYAVAKGYSRWLAIDLL
FT                   LVPTLLGSCLMSFLPKSNQAGLLVGIYMVNTTVAPLILIFAWTGANFKGYTGKVTGCAF
FT                   ISAAFSIANIIGPQTFQARDAPEYLPAKVTIVVANAAAIAVSTALRLLYGSRNREAERL
FT                   GALVSAKSWMEKRVVRQVEEEETGFRYIY"
     MDSKEQDNNL NHDNPTLNDI FEEHEPTSDT SLLRRIDVRI LPIMFLAYFL QFLDKVCLNY        60
     ANVMGIQDEL SMSGNDFSWL ATAFFIAYAV AEVPQGYLLQ KYPVTKVLAA NIFIWGVMLC       120
     CSAAVQNYAG LLALRVLLGT AEAVIAPALT IYTSMWYTPA EASPRFGLWY CGLGTGQILG       180
     GLISFGAQHA SSSQSFSGWR IMFLVIGFAN IAVSLLVLVV LPVSPETASF LSPDAKTRIF       240
     HRLKSAVTGG LGNKTFHAPS VLTTLGDPQT WLLCLLTILV TIPSGLIVTF SSILIKGFGY       300
     TSKESALLNM PSGVVSILSI LLSTYAVAKG YSRWLAIDLL LVPTLLGSCL MSFLPKSNQA       360
     GLLVGIYMVN TTVAPLILIF AWTGANFKGY TGKVTGCAFI SAAFSIANII GPQTFQARDA       420
     PEYLPAKVTI VVANAAAIAV STALRLLYGS RNREAERLGA LVSAKSWMEK RVVRQVEEEE       480
     TGFRYIY                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page