(data stored in ACNUC16935 zone)

EMBL: BN001307.PE144

BN001307.PE144       Location/Qualifiers
FT   CDS             join(401558..401841,401924..401978)
FT                   /locus_tag="ANIA_11154"
FT                   /old_locus_tag="AN11154.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007935"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007935"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007935"
FT                   /db_xref="GOA:C8VLI1"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI1"
FT                   /protein_id="CBF84636.1"
FT                   /translation="MAALQKFKLVFHVPPSSLEPVQKAIFAAGAGRYPGPGNYTECCWV
FT                   TSGTGQFRPGDAANPAIGKVGELEKIEELRVETLCVGVDVARKAVEALKKAHPYEEPSY
FT                   GVIRLEDF"
     MAALQKFKLV FHVPPSSLEP VQKAIFAAGA GRYPGPGNYT ECCWVTSGTG QFRPGDAANP        60
     AIGKVGELEK IEELRVETLC VGVDVARKAV EALKKAHPYE EPSYGVIRLE DF               112
//

If you have problems or comments...

PBIL Back to PBIL home page