(data stored in ACNUC16935 zone)

EMBL: BN001307.PE146

BN001307.PE146       Location/Qualifiers
FT   CDS             410978..412045
FT                   /locus_tag="ANIA_08927"
FT                   /old_locus_tag="AN8927.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007937"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007937"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007937"
FT                   /db_xref="GOA:Q5AS03"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS03"
FT                   /protein_id="CBF84640.1"
FT                   /translation="MTKSNFITAAVLAFAATVSAQCGSGTPDAIVDGSEGAYTATVEGS
FT                   EVYSGSDFYTAITSALDGISSGQRLSILASGSIGTNVVSIPSGRIFEGCGTIDVQANSG
FT                   RGNIRSLNTENVQIPYLTLTGSPYFGLHFYGVSGLSLGQITMNLSGGLGIRFERDEAAN
FT                   SDVSMDVINITGAGSHAVETWNIDGLTINQVIARDVGECGLLLQTTTNARIGTVDGDNV
FT                   AAGTGYATFRMANANGRLSDGSYDTNVYVENVIARGGGRGIFCVSESGGVEIGNVDISD
FT                   TENNAILIENCYGVSILGGSVNGGGDVRIAARDEFENTRDVSISLEVNGANVVENPCGE
FT                   NITWDITGDATLNVC"
     MTKSNFITAA VLAFAATVSA QCGSGTPDAI VDGSEGAYTA TVEGSEVYSG SDFYTAITSA        60
     LDGISSGQRL SILASGSIGT NVVSIPSGRI FEGCGTIDVQ ANSGRGNIRS LNTENVQIPY       120
     LTLTGSPYFG LHFYGVSGLS LGQITMNLSG GLGIRFERDE AANSDVSMDV INITGAGSHA       180
     VETWNIDGLT INQVIARDVG ECGLLLQTTT NARIGTVDGD NVAAGTGYAT FRMANANGRL       240
     SDGSYDTNVY VENVIARGGG RGIFCVSESG GVEIGNVDIS DTENNAILIE NCYGVSILGG       300
     SVNGGGDVRI AARDEFENTR DVSISLEVNG ANVVENPCGE NITWDITGDA TLNVC            355
//

If you have problems or comments...

PBIL Back to PBIL home page