(data stored in ACNUC16935 zone)

EMBL: BN001307.PE148

BN001307.PE148       Location/Qualifiers
FT   CDS             join(414345..414429,414521..414568,414967..415089,
FT                   415165..415210,415245..415248)
FT                   /locus_tag="ANIA_08926"
FT                   /old_locus_tag="AN8926.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007939"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007939"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007939"
FT                   /db_xref="GOA:Q5AS04"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS04"
FT                   /protein_id="CBF84644.1"
FT                   /translation="MPFTAHPNTTSSSNDWSEKDVFAMKVMRKSYGIVVALVVSRILGG
FT                   AGHLGGFQRARKVAGGEDEKGQRGIWRLLGLFYSDKRLGDGSAGEEPDKTIGVLEG"
     MPFTAHPNTT SSSNDWSEKD VFAMKVMRKS YGIVVALVVS RILGGAGHLG GFQRARKVAG        60
     GEDEKGQRGI WRLLGLFYSD KRLGDGSAGE EPDKTIGVLE G                           101
//

If you have problems or comments...

PBIL Back to PBIL home page