(data stored in ACNUC16935 zone)

EMBL: BN001307.PE149

BN001307.PE149       Location/Qualifiers
FT   CDS             join(417218..417441,417540..417732,417829..417924)
FT                   /locus_tag="ANIA_08925"
FT                   /old_locus_tag="AN8925.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007940"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007940"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007940"
FT                   /db_xref="GOA:Q5AS05"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS05"
FT                   /protein_id="CBF84645.1"
FT                   /translation="MEDNALESAVPSAEGCRTAYEKGSASGQAFIGVLSGFPYTCFQFQ
FT                   QALLHQPYFPDDLDLELTYDNISVSGSSICASADLGQSLHNWFKNERTHLTVLVFPWSY
FT                   IFSARWAGLMPKATLAYTDSKAYDSDKPEEDDSAMINFDLPGQYLFRQTSTFPIAKTTI
FT                   RPQIQPY"
     MEDNALESAV PSAEGCRTAY EKGSASGQAF IGVLSGFPYT CFQFQQALLH QPYFPDDLDL        60
     ELTYDNISVS GSSICASADL GQSLHNWFKN ERTHLTVLVF PWSYIFSARW AGLMPKATLA       120
     YTDSKAYDSD KPEEDDSAMI NFDLPGQYLF RQTSTFPIAK TTIRPQIQPY                  170
//

If you have problems or comments...

PBIL Back to PBIL home page