(data stored in ACNUC16935 zone)

EMBL: BN001307.PE15

BN001307.PE15        Location/Qualifiers
FT   CDS             join(46803..47035,47297..47377,47430..47465,47601..47602,
FT                   47788..47922,48166..48215,48273..48417,48482..48498)
FT                   /locus_tag="ANIA_09046"
FT                   /old_locus_tag="AN9046.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007807"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007807"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007807"
FT                   /db_xref="GOA:Q5ARN4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN4"
FT                   /protein_id="CBF84396.1"
FT                   /translation="MPRVRVSSSQNCHEKEGRLLLAVQAIKKKEITLICEAAHHFNVPE
FT                   SILCTRLRGTTNRAESRANGHKLTEIEEEVLKQILPDNIYNFDKTGFAIGLCAHQKVIT
FT                   KLLQLSQSVLLDRILKRSYASLVDQKMWLGISYINKLDFLAAYPQARISIFKLDTIRNS
FT                   CQIAMQKVILLEQENRIAHDNGLSVQEATELEEAYNVSFQAIPGPCGPPAEGAQTPKAW
FT                   ALPIYSVVVD"
     MPRVRVSSSQ NCHEKEGRLL LAVQAIKKKE ITLICEAAHH FNVPESILCT RLRGTTNRAE        60
     SRANGHKLTE IEEEVLKQIL PDNIYNFDKT GFAIGLCAHQ KVITKLLQLS QSVLLDRILK       120
     RSYASLVDQK MWLGISYINK LDFLAAYPQA RISIFKLDTI RNSCQIAMQK VILLEQENRI       180
     AHDNGLSVQE ATELEEAYNV SFQAIPGPCG PPAEGAQTPK AWALPIYSVV VD               232
//

If you have problems or comments...

PBIL Back to PBIL home page