(data stored in ACNUC16935 zone)

EMBL: BN001307.PE150

BN001307.PE150       Location/Qualifiers
FT   CDS             complement(join(419825..420882,420950..421166))
FT                   /locus_tag="ANIA_08924"
FT                   /old_locus_tag="AN8924.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007941"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007941"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007941"
FT                   /db_xref="GOA:C8VLI7"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLI7"
FT                   /protein_id="CBF84647.1"
FT                   /translation="MAPTLPLPPLQRLQNLASRTFDPGATADSFREEWSNPSNYAFTIL
FT                   LLIGGDLIHRALAQLVGGPIAPVAFSFGWVSYATSAVCSALGEYRLMPDADTGCSLING
FT                   KNGYVRGNNSWVLGRMMRDYDYWMHPAIREKTQNLIDARWKFDQAREDEKYPDSGIKVP
FT                   RPSQAGLVVSVYKPSKTLQAGVPGKDLLYWSGILCTVLQLGIASIPAGINGDWGVLMIT
FT                   GAATVLCYGTGALTQWKVEKWACRRLDNRNKKNFVLTRGNGAQHAIAIVSDGVGLDLED
FT                   LATGFSMIDYPTITVVAQLLTIVLGIAWVALLITASGIDTGSWYLIAVGGIGMLQNIFV
FT                   AGWKRTPAAYGVPLEFVEVVGEVKVMGTLMELERRYEKLGKSLLGTFFPGDLRDNEVKQ
FT                   WEEIKEEWKRKKERGEGAGDDRKGK"
     MAPTLPLPPL QRLQNLASRT FDPGATADSF REEWSNPSNY AFTILLLIGG DLIHRALAQL        60
     VGGPIAPVAF SFGWVSYATS AVCSALGEYR LMPDADTGCS LINGKNGYVR GNNSWVLGRM       120
     MRDYDYWMHP AIREKTQNLI DARWKFDQAR EDEKYPDSGI KVPRPSQAGL VVSVYKPSKT       180
     LQAGVPGKDL LYWSGILCTV LQLGIASIPA GINGDWGVLM ITGAATVLCY GTGALTQWKV       240
     EKWACRRLDN RNKKNFVLTR GNGAQHAIAI VSDGVGLDLE DLATGFSMID YPTITVVAQL       300
     LTIVLGIAWV ALLITASGID TGSWYLIAVG GIGMLQNIFV AGWKRTPAAY GVPLEFVEVV       360
     GEVKVMGTLM ELERRYEKLG KSLLGTFFPG DLRDNEVKQW EEIKEEWKRK KERGEGAGDD       420
     RKGK                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page