(data stored in ACNUC16935 zone)

EMBL: BN001307.PE151

BN001307.PE151       Location/Qualifiers
FT   CDS             complement(join(421784..423080,423162..424246))
FT                   /locus_tag="ANIA_08923"
FT                   /old_locus_tag="AN8923.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007942"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007942"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007942"
FT                   /db_xref="GOA:Q5AS07"
FT                   /db_xref="InterPro:IPR010730"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS07"
FT                   /protein_id="CBF84649.1"
FT                   /translation="MEHLPLHAGKKHFIVAPYEAPESDWFDISRESFLSFPSARHWTEA
FT                   QLHGGDETTKDAHLDPDGFHRKGSPQKVEQFFQTWLFFGLAIDVLRFGGVRASVEDFLK
FT                   PATQTHAKARIVNTSRLPGMLVDWEKGIKARGRLMKDWDTLNEMFERAGSILDRFCRLP
FT                   NPEEDNSLLQQERPRLWPVRDEIATTLIAMACTLRRTAYNVCSKEISGLVDGVSPWPKT
FT                   ARSGILMRRLETKWCVADMMTTLTQLPIDGHYYLAASAGLEPDELDHHSKCVRAHCRYE
FT                   YDANMYRTRHVTDDGCREEVRYGGHLGPERGQRDWVDAMTKIIDKDAIPIALWNKGMKK
FT                   LWSVEYHLTGRRRPDFVAISHVWTDGKGNPDANSLPECQLDRIQRLVEGVTWEGRYRIP
FT                   ESDYESDGVGFWMDTLCIPANDKARKDKAITTMRRVYSEAKAVLVLDDWLQEIRSDAPP
FT                   LDLITRIFQSNWIKRLWTHQEGFLPKALWFQFKDRAVEINELREGFGAYESSLQRQGIH
FT                   LGFPRGAEMRLVGQYSVLQRMFGLTSATEKWRLYFPLAAAMSERKTSRLADETICLATI
FT                   VDIPFADLQEIPAKPDIDSGGKRMALFLEKLGKFSTGVIFNNYPRLDQRGYRWAPRSLL
FT                   NFRTAKITSAGAEPGFDIASFNPNRRPGLLAQYHGFLVNFGLGKPFAGVERGCAIQCAG
FT                   SADSGQDLDGKWFLVQLPRNNSNVEWQTWQTYAVILSEIPKQRATAPAVVASLQERQED
FT                   GIHVVIHQNIASVWMTQEPPEGVSTVRTALLRKRTKWLVG"
     MEHLPLHAGK KHFIVAPYEA PESDWFDISR ESFLSFPSAR HWTEAQLHGG DETTKDAHLD        60
     PDGFHRKGSP QKVEQFFQTW LFFGLAIDVL RFGGVRASVE DFLKPATQTH AKARIVNTSR       120
     LPGMLVDWEK GIKARGRLMK DWDTLNEMFE RAGSILDRFC RLPNPEEDNS LLQQERPRLW       180
     PVRDEIATTL IAMACTLRRT AYNVCSKEIS GLVDGVSPWP KTARSGILMR RLETKWCVAD       240
     MMTTLTQLPI DGHYYLAASA GLEPDELDHH SKCVRAHCRY EYDANMYRTR HVTDDGCREE       300
     VRYGGHLGPE RGQRDWVDAM TKIIDKDAIP IALWNKGMKK LWSVEYHLTG RRRPDFVAIS       360
     HVWTDGKGNP DANSLPECQL DRIQRLVEGV TWEGRYRIPE SDYESDGVGF WMDTLCIPAN       420
     DKARKDKAIT TMRRVYSEAK AVLVLDDWLQ EIRSDAPPLD LITRIFQSNW IKRLWTHQEG       480
     FLPKALWFQF KDRAVEINEL REGFGAYESS LQRQGIHLGF PRGAEMRLVG QYSVLQRMFG       540
     LTSATEKWRL YFPLAAAMSE RKTSRLADET ICLATIVDIP FADLQEIPAK PDIDSGGKRM       600
     ALFLEKLGKF STGVIFNNYP RLDQRGYRWA PRSLLNFRTA KITSAGAEPG FDIASFNPNR       660
     RPGLLAQYHG FLVNFGLGKP FAGVERGCAI QCAGSADSGQ DLDGKWFLVQ LPRNNSNVEW       720
     QTWQTYAVIL SEIPKQRATA PAVVASLQER QEDGIHVVIH QNIASVWMTQ EPPEGVSTVR       780
     TALLRKRTKW LVG                                                          793
//

If you have problems or comments...

PBIL Back to PBIL home page