(data stored in ACNUC16935 zone)

EMBL: BN001307.PE153

BN001307.PE153       Location/Qualifiers
FT   CDS             complement(join(425618..425835,425888..425949,
FT                   426005..426237))
FT                   /locus_tag="ANIA_08922"
FT                   /old_locus_tag="AN8922.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007944"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007944"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007944"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS08"
FT                   /protein_id="CBF84653.1"
FT                   /translation="MMPRTSFRVTTLFLAIFCPLTASAAVSGWRKDVTIDAPVTRSSDE
FT                   LRTLWKRRRGDSSGSDSDSDSGSSSGGYGYDDSTSLVKHTAKDICTFTLCGIGKKQASK
FT                   AAIPQGSGTPLSWDNSSGSWISLDFLWSPVSMIPPTSPTSASNPKYFSTSPTTQTWAPS
FT                   HFTFSGA"
     MMPRTSFRVT TLFLAIFCPL TASAAVSGWR KDVTIDAPVT RSSDELRTLW KRRRGDSSGS        60
     DSDSDSGSSS GGYGYDDSTS LVKHTAKDIC TFTLCGIGKK QASKAAIPQG SGTPLSWDNS       120
     SGSWISLDFL WSPVSMIPPT SPTSASNPKY FSTSPTTQTW APSHFTFSGA                  170
//

If you have problems or comments...

PBIL Back to PBIL home page