(data stored in ACNUC16935 zone)

EMBL: BN001307.PE154

BN001307.PE154       Location/Qualifiers
FT   CDS             complement(join(427417..427441,427523..427549,
FT                   427623..427672,427890..429042,429103..429653))
FT                   /locus_tag="ANIA_08921"
FT                   /old_locus_tag="AN8921.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007945"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007945"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007945"
FT                   /db_xref="GOA:Q5AS09"
FT                   /db_xref="InterPro:IPR000033"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS09"
FT                   /protein_id="CBF84655.1"
FT                   /translation="MTRPIVVLGAGVLGRRIAAVLIAGGHTVHIRDPSTQALSDAASFI
FT                   DAHLHEFTAITPTPHPVPGTYKAFAEISSAVAGAWLVIEAVPEKLSLKIDTFAEVDRHA
FT                   PADCVIASNSSSFKSSLMVEKVGEQRKERVLNVHFTMPPQIRTVELMTNGQTRPELFES
FT                   LSKMLKGCGMIPVTARKESTGFIFNRLWAAIKREIMLILAEDVSTPEEIDLLWTNMFQL
FT                   PTSSPPCQLMDKIGLDTVAFIEDNYIQERGLDGSMTVDWLRKSYIDQGRLGLKSEKGGL
FT                   YGPSAAAAPAAATKAAQSLYILDVGLGSNNKVDQIPTAGKILYFDQSTGNMSPIVTGQS
FT                   LPDGVDVSKSTGRLFWTNMGRATSTRDGSVHSAKLDGSDMQTLLPTGSVHTPKQLVVDD
FT                   MNRKIYFCDREGMGVHRCNFDGSGHEVLIQTGSLDCAEHRSDLTRWCVGIAVDTPHRYI
FT                   YWTQKGPSKAGRGRIFRAGLEIPAGQTAENRTDIELLLDGLPEPIDLDLEVKSQKLYWT
FT                   DRGEHPIGCSLNCVDLSGSTQLEKLKSNKEILARHFNEPIGLRVAGDGTVYLIKKCVIL
FT                   QGSASLYKQDSDITHRSRNYLSSMA"
     MTRPIVVLGA GVLGRRIAAV LIAGGHTVHI RDPSTQALSD AASFIDAHLH EFTAITPTPH        60
     PVPGTYKAFA EISSAVAGAW LVIEAVPEKL SLKIDTFAEV DRHAPADCVI ASNSSSFKSS       120
     LMVEKVGEQR KERVLNVHFT MPPQIRTVEL MTNGQTRPEL FESLSKMLKG CGMIPVTARK       180
     ESTGFIFNRL WAAIKREIML ILAEDVSTPE EIDLLWTNMF QLPTSSPPCQ LMDKIGLDTV       240
     AFIEDNYIQE RGLDGSMTVD WLRKSYIDQG RLGLKSEKGG LYGPSAAAAP AAATKAAQSL       300
     YILDVGLGSN NKVDQIPTAG KILYFDQSTG NMSPIVTGQS LPDGVDVSKS TGRLFWTNMG       360
     RATSTRDGSV HSAKLDGSDM QTLLPTGSVH TPKQLVVDDM NRKIYFCDRE GMGVHRCNFD       420
     GSGHEVLIQT GSLDCAEHRS DLTRWCVGIA VDTPHRYIYW TQKGPSKAGR GRIFRAGLEI       480
     PAGQTAENRT DIELLLDGLP EPIDLDLEVK SQKLYWTDRG EHPIGCSLNC VDLSGSTQLE       540
     KLKSNKEILA RHFNEPIGLR VAGDGTVYLI KKCVILQGSA SLYKQDSDIT HRSRNYLSSM       600
     A                                                                       601
//

If you have problems or comments...

PBIL Back to PBIL home page