(data stored in ACNUC16935 zone)

EMBL: BN001307.PE155

BN001307.PE155       Location/Qualifiers
FT   CDS             complement(join(430268..430270,430351..430513,
FT                   430556..431529,431583..431743,431792..431867))
FT                   /locus_tag="ANIA_08920"
FT                   /old_locus_tag="AN8920.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007946"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007946"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007946"
FT                   /db_xref="GOA:Q5AS10"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS10"
FT                   /protein_id="CBF84656.1"
FT                   /translation="MPSYTLEQVKAHCTPDDIWIILHNKVYEVTKYLEDHPGGSAVLIE
FT                   VAGADATEAFEEIGHSDEAREQLEPYYIGDLPDQEQAESVEIYRPTFEQVSQSAVINTK
FT                   KTSKSFSSLLSVLVKLGLTGAVGAATIAVFQKNWTPRQLLHALPALTTPIPLPRISGSG
FT                   GSQFWSGVGIATITQLSLSFGLGVWVSTKLDVQQEFTHYPPRRPASSARLIRLPSTTRA
FT                   LAPRSPVLDPRQWRSFPLTSKKEVAPNVYRLVFALPKADDILGLPTGQHVALRATVDGK
FT                   TVQRSYTPISNNTDRGHIELLIKVYPKGLLTNHLAQMEVGETIEMRGPKGAMKYSAQYA
FT                   YRIGMIAGGTGITPMYQLIRAICEDESDNTQVSLLYANNGEADILLREELESFAGRFPH
FT                   KFKMEGFVNGEMIAKHIGSPADDAKVLLCGPPPMVEAMKKTLAGMGWDMPGAIANGTDQ
FT                   "
     MPSYTLEQVK AHCTPDDIWI ILHNKVYEVT KYLEDHPGGS AVLIEVAGAD ATEAFEEIGH        60
     SDEAREQLEP YYIGDLPDQE QAESVEIYRP TFEQVSQSAV INTKKTSKSF SSLLSVLVKL       120
     GLTGAVGAAT IAVFQKNWTP RQLLHALPAL TTPIPLPRIS GSGGSQFWSG VGIATITQLS       180
     LSFGLGVWVS TKLDVQQEFT HYPPRRPASS ARLIRLPSTT RALAPRSPVL DPRQWRSFPL       240
     TSKKEVAPNV YRLVFALPKA DDILGLPTGQ HVALRATVDG KTVQRSYTPI SNNTDRGHIE       300
     LLIKVYPKGL LTNHLAQMEV GETIEMRGPK GAMKYSAQYA YRIGMIAGGT GITPMYQLIR       360
     AICEDESDNT QVSLLYANNG EADILLREEL ESFAGRFPHK FKMEGFVNGE MIAKHIGSPA       420
     DDAKVLLCGP PPMVEAMKKT LAGMGWDMPG AIANGTDQ                               458
//

If you have problems or comments...

PBIL Back to PBIL home page