(data stored in ACNUC16935 zone)

EMBL: BN001307.PE158

BN001307.PE158       Location/Qualifiers
FT   CDS             complement(join(436160..436295,436459..437594))
FT                   /locus_tag="ANIA_12277"
FT                   /old_locus_tag="AN11685.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00010530"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00010530"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00010530"
FT                   /db_xref="GOA:C8VLJ5"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C8VLJ5"
FT                   /protein_id="CBF84662.1"
FT                   /translation="MPLLFSFFLFVYLYISSSLFFDIVHFCLHQWSSSRYEALRWLSRC
FT                   HQFHHLYYNRSLNFNSRYRWQNSWFALPLEAACLCIGGLLGWFFLMLLPVIEQKHVLRT
FT                   PLIAILAVHIIRTSVVIYMSGQDSNHVVYKTVPKDPSWLFVGPQFHALHHVHPDRYMGS
FT                   VVKVFDWLAGTAYSLRNKSVVITGGSGALGSAIIRRLRSEGVRNVYSLKFGEHWTHGDF
FT                   NRVGPIFDHLEPDILILAHGTKGEDAMDANCNSTIRLIQLYLEQRAGRTPASATKTLPE
FT                   VWYIGSEVELHPAFGGAEMYRYLDSKRAFLPYARALYDDSGVVYRHIVPAAFQSRMGRA
FT                   IVSADWAAGVMMWWIRRGARYVPVTYTGFAYSNFFKFFCSRNTIDGVPVDSARVRPDRS
FT                   GIGVGRQRHGASSSSDVCRINPAL"
     MPLLFSFFLF VYLYISSSLF FDIVHFCLHQ WSSSRYEALR WLSRCHQFHH LYYNRSLNFN        60
     SRYRWQNSWF ALPLEAACLC IGGLLGWFFL MLLPVIEQKH VLRTPLIAIL AVHIIRTSVV       120
     IYMSGQDSNH VVYKTVPKDP SWLFVGPQFH ALHHVHPDRY MGSVVKVFDW LAGTAYSLRN       180
     KSVVITGGSG ALGSAIIRRL RSEGVRNVYS LKFGEHWTHG DFNRVGPIFD HLEPDILILA       240
     HGTKGEDAMD ANCNSTIRLI QLYLEQRAGR TPASATKTLP EVWYIGSEVE LHPAFGGAEM       300
     YRYLDSKRAF LPYARALYDD SGVVYRHIVP AAFQSRMGRA IVSADWAAGV MMWWIRRGAR       360
     YVPVTYTGFA YSNFFKFFCS RNTIDGVPVD SARVRPDRSG IGVGRQRHGA SSSSDVCRIN       420
     PAL                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page