(data stored in ACNUC16935 zone)

EMBL: BN001307.PE159

BN001307.PE159       Location/Qualifiers
FT   CDS             441682..442767
FT                   /locus_tag="ANIA_08917"
FT                   /old_locus_tag="AN8917.4"
FT                   /product="DUF636 domain protein (AFU_orthologue;
FT                   AFUA_2G12650)"
FT                   /note="transcript_id=CADANIAT00007948"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007948"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007948"
FT                   /db_xref="GOA:Q5AS13"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS13"
FT                   /protein_id="CBF84664.1"
FT                   /translation="MSTKTLTIRCHCRSTHFALTVEPTSLPLRAHLCHCTLCRTTHGTT
FT                   ASYHAPLPEGVKPSFIAPSSWDNLTAYTPPGSGAKLYFCSTCGCQVGGTNVLGIWDTVV
FT                   SIIEGGNEEDAIWVIDEHIYTEKGSTGDGGIAELLPRIGERELRVWNPDIKGTEFPTAG
FT                   SGAAGRSASHNRQDDKLLAQCNCGGVSFTISRPREDFMNSPLSKGWIHPSFRTKWLALL
FT                   DVCDDCRLLTGAHVTTWLFVPIDHITPSLPDDLVIGTMKRYESTPGTVSRTFCGTCGAT
FT                   VFCYYDKRGGIVDIATGILRAPEGVMLGDWAVWRTAKLGFKDDGRRYDKLFTEGLEKGA
FT                   KEWGRRVHGEVIDFQGGPATD"
     MSTKTLTIRC HCRSTHFALT VEPTSLPLRA HLCHCTLCRT THGTTASYHA PLPEGVKPSF        60
     IAPSSWDNLT AYTPPGSGAK LYFCSTCGCQ VGGTNVLGIW DTVVSIIEGG NEEDAIWVID       120
     EHIYTEKGST GDGGIAELLP RIGERELRVW NPDIKGTEFP TAGSGAAGRS ASHNRQDDKL       180
     LAQCNCGGVS FTISRPREDF MNSPLSKGWI HPSFRTKWLA LLDVCDDCRL LTGAHVTTWL       240
     FVPIDHITPS LPDDLVIGTM KRYESTPGTV SRTFCGTCGA TVFCYYDKRG GIVDIATGIL       300
     RAPEGVMLGD WAVWRTAKLG FKDDGRRYDK LFTEGLEKGA KEWGRRVHGE VIDFQGGPAT       360
     D                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page