(data stored in ACNUC16935 zone)

EMBL: BN001307.PE16

BN001307.PE16        Location/Qualifiers
FT   CDS             join(49259..49861,49909..50526,50596..50724)
FT                   /locus_tag="ANIA_09045"
FT                   /old_locus_tag="AN9045.4"
FT                   /product="Exo-polygalacturonasePutative uncharacterized
FT                   protein ; [Source:UniProtKB/TrEMBL;Acc:Q5ARN5]"
FT                   /note="transcript_id=CADANIAT00007808"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007808"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007808"
FT                   /db_xref="GOA:Q5ARN5"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5ARN5"
FT                   /protein_id="CBF84398.1"
FT                   /translation="MGFKRTIGLLLGILLALDQVSVLAQPGRPTFAKRPDIQPNPIQPY
FT                   KAIPLHSRRNSHKVCYVKPSLNGGDDAGRVEAALRRCNNGGTIVLDKEYSICTPLDLRF
FT                   LKHVDVALTGKVEFCPELEFWQQNVFQFHFQNASSWWVWGGEDIHLYGAGTGVIHGNGQ
FT                   PWWDAAAGNSSVRRPLLFITDGWHGGSITGLKLRQSPNWHNFIANSSDLLISDMDIFSR
FT                   SSSEAWASNLDGWDTFRSDNVVIQNSVINHDDDCVSFKPNSTNIIVQGLHCNGSHGISV
FT                   GSLGNYPYQYDIVSDLYIYNNTMANTTTAARLKVWPGAEAVKKGNPPWVGGGGKGYVRN
FT                   VTYDLMINDNNDLAIQIDQCYGAINASECLDHPSGVILTNVLFKNMWGTSNGANDPVAG
FT                   QLICGSADSCDNIRAENVTLTNSSGQPSEWQCRYMDEELLDLGGVGCIPA"
     MGFKRTIGLL LGILLALDQV SVLAQPGRPT FAKRPDIQPN PIQPYKAIPL HSRRNSHKVC        60
     YVKPSLNGGD DAGRVEAALR RCNNGGTIVL DKEYSICTPL DLRFLKHVDV ALTGKVEFCP       120
     ELEFWQQNVF QFHFQNASSW WVWGGEDIHL YGAGTGVIHG NGQPWWDAAA GNSSVRRPLL       180
     FITDGWHGGS ITGLKLRQSP NWHNFIANSS DLLISDMDIF SRSSSEAWAS NLDGWDTFRS       240
     DNVVIQNSVI NHDDDCVSFK PNSTNIIVQG LHCNGSHGIS VGSLGNYPYQ YDIVSDLYIY       300
     NNTMANTTTA ARLKVWPGAE AVKKGNPPWV GGGGKGYVRN VTYDLMINDN NDLAIQIDQC       360
     YGAINASECL DHPSGVILTN VLFKNMWGTS NGANDPVAGQ LICGSADSCD NIRAENVTLT       420
     NSSGQPSEWQ CRYMDEELLD LGGVGCIPA                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page