(data stored in ACNUC16935 zone)

EMBL: BN001307.PE161

BN001307.PE161       Location/Qualifiers
FT   CDS             complement(join(449886..452659,452709..453723))
FT                   /locus_tag="ANIA_09426"
FT                   /old_locus_tag="AN9426.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007949"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007949"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007949"
FT                   /db_xref="GOA:Q5AQK4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AQK4"
FT                   /protein_id="CBF84668.1"
FT                   /translation="MRPKSRSDFTVAVICALPLEADAVEALFDEHYDRLGEYYGKQPGD
FT                   ANAYLNGRIGNHNVVLCYMPGIGKESAASVASSLQVSYTEIKLALVVGICGGAPSPPVY
FT                   QEIFLGDVMISDSVIEYDFGRQYPGGFQQKSAVKDILGRPSQEIRALLNGLRAENARNE
FT                   FQSQIREHLHVLQQRGAKWHRPYIKDILFNASYLHKHYSDAPAGCSCLRSNSPDEICEM
FT                   ALEEDCDSLGCDKKQAVRCRKTLENIQPSVYVGPIASADTVMKSGQYRDELVRKEKVIG
FT                   FEMEGAGVWDNLPCIIIKGVCDYADSHKSKSWQAYAAATGASAAKAFLKYWMSANRKGA
FT                   NRSRNRHLVIPFGRNSRFVGRQDEIHKLESLIFMPDGPRKLAITGLGGVGKTQVALELA
FT                   YRMRDREADCSIFWVPCTSYEVAEQALLSIAQRVEIQDTQPEKLKERLKTYFGQEDKNW
FT                   LLIFDNADDMDMWTKGSNDTPPLKDFLPLNNQGHIIFTTRNRELAVDLASPYVMQVPEL
FT                   DRKTGMEFLEKSLCKDLLHDSHAMIRLLEQLTFLPLAISQATAYINKKGLKVSDYLTLL
FT                   EEQETDVVELLSKDFGDDQRYTDVQNPVAKTWLISFKQIQKLDQLAVEYLLLMACINPR
FT                   NIPQAFLPPRSKLQMSDALGLLNAFFFITIQPENGYISLHRLVHLATRNWMRKEGWFPL
FT                   WITKTTDRLSSIFPHNDHANRQVWREYLPHALSLLRETEFHKHQEQYVDYIEKVGTCLD
FT                   SDGRYNEAEKLQAQVIEARKKVLGPEHPSTLTSVHNLASTYRNQGRWSEAEELQEQVIK
FT                   TWKQVLGLKHPFTLTSMGNLALIYWNRGRWKEAEELLAQVMENRKQVLGLVHPDTLASV
FT                   HNLAATYLDRGRWKEAEELFVQLVETRKQVVGLEHPDTLTSMHNLASTYRNQGRWKEAE
FT                   ELLTHILEAWKRVMGSEHPSTLTSMHNLASIFWCQGRWKEAEELLTEVIETRKRVLGPE
FT                   HPDTLSSLHNLASRYLDIGHWKEAEGLLAQVMETRKQVLGPAHPSTLTCMHNLASAYQN
FT                   QGRLEEAEELQVRVMEAWKQVVGSKHPSTLTSMDNLATTYRKQGRWNEAEELQVQVMET
FT                   WTQVLGPEHPDTLISMANLASLYYNQGQWNKAEKLQVQVMETRKQVLGPEHPHTLTSML
FT                   NLAFTFKNLGNNLDALRLIKGYAGLCNKVLGSNHPQAILSLSTLNEWESEAEQLTKGQK
FT                   QQTLADTSSSLALPQSYAGEQGASELKTAGGKRRRLS"
     MRPKSRSDFT VAVICALPLE ADAVEALFDE HYDRLGEYYG KQPGDANAYL NGRIGNHNVV        60
     LCYMPGIGKE SAASVASSLQ VSYTEIKLAL VVGICGGAPS PPVYQEIFLG DVMISDSVIE       120
     YDFGRQYPGG FQQKSAVKDI LGRPSQEIRA LLNGLRAENA RNEFQSQIRE HLHVLQQRGA       180
     KWHRPYIKDI LFNASYLHKH YSDAPAGCSC LRSNSPDEIC EMALEEDCDS LGCDKKQAVR       240
     CRKTLENIQP SVYVGPIASA DTVMKSGQYR DELVRKEKVI GFEMEGAGVW DNLPCIIIKG       300
     VCDYADSHKS KSWQAYAAAT GASAAKAFLK YWMSANRKGA NRSRNRHLVI PFGRNSRFVG       360
     RQDEIHKLES LIFMPDGPRK LAITGLGGVG KTQVALELAY RMRDREADCS IFWVPCTSYE       420
     VAEQALLSIA QRVEIQDTQP EKLKERLKTY FGQEDKNWLL IFDNADDMDM WTKGSNDTPP       480
     LKDFLPLNNQ GHIIFTTRNR ELAVDLASPY VMQVPELDRK TGMEFLEKSL CKDLLHDSHA       540
     MIRLLEQLTF LPLAISQATA YINKKGLKVS DYLTLLEEQE TDVVELLSKD FGDDQRYTDV       600
     QNPVAKTWLI SFKQIQKLDQ LAVEYLLLMA CINPRNIPQA FLPPRSKLQM SDALGLLNAF       660
     FFITIQPENG YISLHRLVHL ATRNWMRKEG WFPLWITKTT DRLSSIFPHN DHANRQVWRE       720
     YLPHALSLLR ETEFHKHQEQ YVDYIEKVGT CLDSDGRYNE AEKLQAQVIE ARKKVLGPEH       780
     PSTLTSVHNL ASTYRNQGRW SEAEELQEQV IKTWKQVLGL KHPFTLTSMG NLALIYWNRG       840
     RWKEAEELLA QVMENRKQVL GLVHPDTLAS VHNLAATYLD RGRWKEAEEL FVQLVETRKQ       900
     VVGLEHPDTL TSMHNLASTY RNQGRWKEAE ELLTHILEAW KRVMGSEHPS TLTSMHNLAS       960
     IFWCQGRWKE AEELLTEVIE TRKRVLGPEH PDTLSSLHNL ASRYLDIGHW KEAEGLLAQV      1020
     METRKQVLGP AHPSTLTCMH NLASAYQNQG RLEEAEELQV RVMEAWKQVV GSKHPSTLTS      1080
     MDNLATTYRK QGRWNEAEEL QVQVMETWTQ VLGPEHPDTL ISMANLASLY YNQGQWNKAE      1140
     KLQVQVMETR KQVLGPEHPH TLTSMLNLAF TFKNLGNNLD ALRLIKGYAG LCNKVLGSNH      1200
     PQAILSLSTL NEWESEAEQL TKGQKQQTLA DTSSSLALPQ SYAGEQGASE LKTAGGKRRR      1260
     LS                                                                     1262
//

If you have problems or comments...

PBIL Back to PBIL home page