(data stored in ACNUC16935 zone)

EMBL: BN001307.PE164

BN001307.PE164       Location/Qualifiers
FT   CDS             complement(join(462097..462525,462590..463189,
FT                   463249..463508,463585..464112,464163..464166))
FT                   /locus_tag="ANIA_08915"
FT                   /old_locus_tag="AN8915.4"
FT                   /product="hypothetical peptide transporter (Eurofung)"
FT                   /note="transcript_id=CADANIAT00007952"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007952"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007952"
FT                   /db_xref="GOA:Q5AS15"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS15"
FT                   /protein_id="CBF84674.1"
FT                   /translation="MEPVLNEKTGAPAVEDVVAVSDYEEPTEEELKTLRRIPGALPTVA
FT                   YLICIVEFCERASYLGVSGLISNFVNRPLPAGGNGYGAPARGTQDTAGALGMGTVKANA
FT                   VSQSFSMLAYLLPMFFGYLSDAHTGRFKMILYGVAVFGVAHVLMVGATAPKLLANGGAK
FT                   APYFISLYMLSVGASMFKPNVSPLLLDQMPRDKAKIKVLPSGERVIVDPEATSERTMLW
FT                   FYLLINIGGFMQTATSYAEKYVGWWLAFILPLFLYIPLPLLLIWLRKRLVLFPPGGSDL
FT                   PNVVRVLKICLSRGGIFRIGRHGFWDAAKPSVIAAKGQNIRTQWNDQFVEDVRRTFQAT
FT                   GIFCFFPIQYINDNGLGSAASFLSTMLKTDGVPNDLISNFNPLSIIFFAPILNYGLYPL
FT                   LRRWKIHYGPVARMATGLFISSIGGIGYTVLNYYAYKLGPCGKWGSSDTCVDENGNTRV
FT                   APITIWWIAIPYAIGGISELFINVPAYGIAYSRAPKNMRGLVSAINLLNTAVAYAIGLA
FT                   CSAVIKDPYLTWDFGGPSIVGFVLTVIFYFMFRHIDKEEYFLTEMAENENETTAQPKES
FT                   ALSENGDKTLSPVEKVADNEPEKIGVSLKQ"
     MEPVLNEKTG APAVEDVVAV SDYEEPTEEE LKTLRRIPGA LPTVAYLICI VEFCERASYL        60
     GVSGLISNFV NRPLPAGGNG YGAPARGTQD TAGALGMGTV KANAVSQSFS MLAYLLPMFF       120
     GYLSDAHTGR FKMILYGVAV FGVAHVLMVG ATAPKLLANG GAKAPYFISL YMLSVGASMF       180
     KPNVSPLLLD QMPRDKAKIK VLPSGERVIV DPEATSERTM LWFYLLINIG GFMQTATSYA       240
     EKYVGWWLAF ILPLFLYIPL PLLLIWLRKR LVLFPPGGSD LPNVVRVLKI CLSRGGIFRI       300
     GRHGFWDAAK PSVIAAKGQN IRTQWNDQFV EDVRRTFQAT GIFCFFPIQY INDNGLGSAA       360
     SFLSTMLKTD GVPNDLISNF NPLSIIFFAP ILNYGLYPLL RRWKIHYGPV ARMATGLFIS       420
     SIGGIGYTVL NYYAYKLGPC GKWGSSDTCV DENGNTRVAP ITIWWIAIPY AIGGISELFI       480
     NVPAYGIAYS RAPKNMRGLV SAINLLNTAV AYAIGLACSA VIKDPYLTWD FGGPSIVGFV       540
     LTVIFYFMFR HIDKEEYFLT EMAENENETT AQPKESALSE NGDKTLSPVE KVADNEPEKI       600
     GVSLKQ                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page