(data stored in ACNUC16935 zone)

EMBL: BN001307.PE165

BN001307.PE165       Location/Qualifiers
FT   CDS             complement(join(466493..466704,466759..466897))
FT                   /locus_tag="ANIA_08914"
FT                   /old_locus_tag="AN8914.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007953"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007953"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007953"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS16"
FT                   /protein_id="CBF84675.1"
FT                   /translation="MPSCAVAHAIGNVRKPGIALLFAPEQPMVKEHDVKKWHVVYQNRF
FT                   DCWEGPLRIQGTSAFREMEAYNLERRISMYDQAEWVADLNVLKSLGQSLICECVVSMVN
FT                   IAVMIHPCQRAK"
     MPSCAVAHAI GNVRKPGIAL LFAPEQPMVK EHDVKKWHVV YQNRFDCWEG PLRIQGTSAF        60
     REMEAYNLER RISMYDQAEW VADLNVLKSL GQSLICECVV SMVNIAVMIH PCQRAK           116
//

If you have problems or comments...

PBIL Back to PBIL home page