(data stored in ACNUC16935 zone)

EMBL: BN001307.PE166

BN001307.PE166       Location/Qualifiers
FT   CDS             join(470132..470250,470325..470799)
FT                   /locus_tag="ANIA_08913"
FT                   /old_locus_tag="AN8913.4"
FT                   /product="hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007954"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007954"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007954"
FT                   /db_xref="GOA:Q5AS17"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS17"
FT                   /protein_id="CBF84677.1"
FT                   /translation="MKPWILAFLALSACALAQETETPGPSPTESVGCEPHGDHWHCDAP
FT                   ATSTETDLESTSETLPPSPTESIGCEPHGDHWHCDAPATTTESESESDATSTSTTTATD
FT                   GEASESESASLSPSPTESVGCEPHGDHWHCDGPAETESASSDSSSSAAADATATDEAGA
FT                   EETGGEQPEDGAGIVGVKLSGVVAMAIGAAAVLL"
     MKPWILAFLA LSACALAQET ETPGPSPTES VGCEPHGDHW HCDAPATSTE TDLESTSETL        60
     PPSPTESIGC EPHGDHWHCD APATTTESES ESDATSTSTT TATDGEASES ESASLSPSPT       120
     ESVGCEPHGD HWHCDGPAET ESASSDSSSS AAADATATDE AGAEETGGEQ PEDGAGIVGV       180
     KLSGVVAMAI GAAAVLL                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page