(data stored in ACNUC16935 zone)

EMBL: BN001307.PE168

BN001307.PE168       Location/Qualifiers
FT   CDS             complement(join(474152..474403,474469..474841,
FT                   474888..475624,475700..475807))
FT                   /locus_tag="ANIA_08911"
FT                   /old_locus_tag="AN8911.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007956"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007956"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007956"
FT                   /db_xref="GOA:Q5AS19"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS19"
FT                   /protein_id="CBF84681.1"
FT                   /translation="MAEPKPSTSYIESVGDEKAISYDPKETEEYDPNDPQNWSTVSRLT
FT                   TYLTICFYTFLANVNSSNFTVATKAIVQEFGVSQTQAGELVCFNVFLFGLGNIFWVPLM
FT                   RVVGKRPVYLTSMLLLCMMNVWSSRASSYGELLSSRILSGFAAAAADATVPAVVSDMVA
FT                   PQDRGHYLMVFHLALTSGLFIGPLINAYLVQEENWRWMCYFLAVAVGVVFVTAIFTVRE
FT                   TTYRRDRPRSGRRTPWQWMSLTLGYNPDASFVRTLLDIVWNVGYPQLLWAAFAIGISVG
FT                   WNIVVQLTASRTFTAPPYNWSAGSLGLLSLSGFIGSVLAFYLGGRLIDIISTRYTKRSG
FT                   QRLPEYRLPAIVIPGVIGPGGLLIFGLCIAHQVHWIGAAVGYAMQAFGVAAISNVAVTY
FT                   CLDCYKPLTGEALVIIFVIRNTIGMLLSLYAADWITQQGPAAVFGEMTAIQAASILLAI
FT                   PLFSWGGPLRAWTSRYGPMKRFMSAGENRCL"
     MAEPKPSTSY IESVGDEKAI SYDPKETEEY DPNDPQNWST VSRLTTYLTI CFYTFLANVN        60
     SSNFTVATKA IVQEFGVSQT QAGELVCFNV FLFGLGNIFW VPLMRVVGKR PVYLTSMLLL       120
     CMMNVWSSRA SSYGELLSSR ILSGFAAAAA DATVPAVVSD MVAPQDRGHY LMVFHLALTS       180
     GLFIGPLINA YLVQEENWRW MCYFLAVAVG VVFVTAIFTV RETTYRRDRP RSGRRTPWQW       240
     MSLTLGYNPD ASFVRTLLDI VWNVGYPQLL WAAFAIGISV GWNIVVQLTA SRTFTAPPYN       300
     WSAGSLGLLS LSGFIGSVLA FYLGGRLIDI ISTRYTKRSG QRLPEYRLPA IVIPGVIGPG       360
     GLLIFGLCIA HQVHWIGAAV GYAMQAFGVA AISNVAVTYC LDCYKPLTGE ALVIIFVIRN       420
     TIGMLLSLYA ADWITQQGPA AVFGEMTAIQ AASILLAIPL FSWGGPLRAW TSRYGPMKRF       480
     MSAGENRCL                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page