(data stored in ACNUC16935 zone)

EMBL: BN001307.PE17

BN001307.PE17        Location/Qualifiers
FT   CDS             complement(join(50772..51099,51297..51568))
FT                   /locus_tag="ANIA_09044"
FT                   /old_locus_tag="AN9044.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007809"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007809"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007809"
FT                   /db_xref="GOA:Q5ARN6"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q5ARN6"
FT                   /protein_id="CBF84400.1"
FT                   /translation="MAPLLERTVTAEKANGGWPDKVYAPSALAYNQAYLVSPAMTVQQI
FT                   RDFKQAFDDAALRSVKAGLDLVEIHAAHGYLLHQFLSPVSNSQADEVDFLDVSSGGIRA
FT                   KQETSIKSGDGYRAPFALEIKRAVGNVLLVCMVGGVKKTGEIAERFLQQGLDVVMCGRW
FT                   FQKNPGLVYQFADELGVKINMSTQYGRAFQGGRNRR"
     MAPLLERTVT AEKANGGWPD KVYAPSALAY NQAYLVSPAM TVQQIRDFKQ AFDDAALRSV        60
     KAGLDLVEIH AAHGYLLHQF LSPVSNSQAD EVDFLDVSSG GIRAKQETSI KSGDGYRAPF       120
     ALEIKRAVGN VLLVCMVGGV KKTGEIAERF LQQGLDVVMC GRWFQKNPGL VYQFADELGV       180
     KINMSTQYGR AFQGGRNRR                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page