(data stored in ACNUC16935 zone)

EMBL: BN001307.PE170

BN001307.PE170       Location/Qualifiers
FT   CDS             join(488493..489246,489298..489620)
FT                   /locus_tag="ANIA_08909"
FT                   /old_locus_tag="AN8909.4"
FT                   /product="conserved hypothetical protein"
FT                   /note="transcript_id=CADANIAT00007958"
FT                   /db_xref="EnsemblGenomes-Gn:CADANIAG00007958"
FT                   /db_xref="EnsemblGenomes-Tr:CADANIAT00007958"
FT                   /db_xref="GOA:Q5AS21"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:Q5AS21"
FT                   /protein_id="CBF84685.1"
FT                   /translation="MDHLNLSPPQSLIQNLELCVSNDHISSLTPDLLLHIFGYLREDGR
FT                   SLCNYALVCRRWQKLLEPLIYNTIQVYNEAPTPPRAFSVVRFKHFVGGLNNVRRRAMVR
FT                   KLVFHYQATQFPRGPGETASRAQDPAQNPTDAGFRKAVAGLFQTLRFWEPWYKIELDIA
FT                   LAYSYTGAPRLASMANPSTTADLVTFPTVHCVAEIAFHYSEHGQVFQRIWEATPFHIAQ
FT                   SCANLASLVMDSDAFKLTGRQAPVIRRRKVIAECLDGLPATIENFSMRVIGVSNPYVLD
FT                   WFTPEEDPFSCKLLRITTHLHAIKLYNVTIPVDFWCPLDKNYRPKRDRPVWPCLTHILS
FT                   DDNCLVEGTGKLVLVRLI"
     MDHLNLSPPQ SLIQNLELCV SNDHISSLTP DLLLHIFGYL REDGRSLCNY ALVCRRWQKL        60
     LEPLIYNTIQ VYNEAPTPPR AFSVVRFKHF VGGLNNVRRR AMVRKLVFHY QATQFPRGPG       120
     ETASRAQDPA QNPTDAGFRK AVAGLFQTLR FWEPWYKIEL DIALAYSYTG APRLASMANP       180
     STTADLVTFP TVHCVAEIAF HYSEHGQVFQ RIWEATPFHI AQSCANLASL VMDSDAFKLT       240
     GRQAPVIRRR KVIAECLDGL PATIENFSMR VIGVSNPYVL DWFTPEEDPF SCKLLRITTH       300
     LHAIKLYNVT IPVDFWCPLD KNYRPKRDRP VWPCLTHILS DDNCLVEGTG KLVLVRLI         358
//

If you have problems or comments...

PBIL Back to PBIL home page